Dbfetch
ID AJ276206; SV 1; linear; genomic DNA; STD; HUM; 270 BP. XX AC AJ276206; XX DT 25-JAN-2001 (Rel. 66, Created) DT 17-JUN-2008 (Rel. 96, Last updated, Version 3) XX DE Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, exon 2 XX KW HLA-DRB1 gene; human leukocyte antigen; major histocompatibility complex; KW MHC class II antigen. XX OS Homo sapiens (human) OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; OC Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; OC Homo. XX RN [1] RP 1-270 RA van den Berg-Loonen E.M.; RT ; RL Submitted (19-JUL-2000) to the INSDC. RL van den Berg-Loonen E.M., Tissue Typing Laboratory, University Hospital RL Maastricht, P.O. Box 5800, 6202 AZ Maastricht, NETHERLANDS. XX RN [2] RA Voorter C.E., Hepkema B., Lems S., van den Berg-Loonen E.; RT "A new HLA DRB1 allele identified by sequence based typing"; RL Unpublished. XX DR MD5; 51339393c142a43dd793e73dba8d1af8. DR IMGT/HLA; HLA-DRB1*01:07; HLA01307. XX FH Key Location/Qualifiers FH FT source 1..270 FT /organism="Homo sapiens" FT /mol_type="genomic DNA" FT /db_xref="taxon:9606" FT CDS <1..>270 FT /codon_start=3 FT /gene="HLA-DRB1" FT /standard_name="MHC class I antigen" FT /product="human leukocyte antigen" FT /function="antigen presenting molecule" FT /db_xref="GOA:P04229" FT /db_xref="HGNC:HGNC:4948" FT /db_xref="InterPro:IPR000353" FT /db_xref="InterPro:IPR003006" FT /db_xref="InterPro:IPR003597" FT /db_xref="InterPro:IPR007110" FT /db_xref="InterPro:IPR011162" FT /db_xref="InterPro:IPR013783" FT /db_xref="InterPro:IPR014745" FT /db_xref="InterPro:IPR036179" FT /db_xref="PDB:1AQD" FT /db_xref="PDB:1DLH" FT /db_xref="PDB:1FYT" FT /db_xref="PDB:1HXY" FT /db_xref="PDB:1JWM" FT /db_xref="PDB:1JWS" FT /db_xref="PDB:1JWU" FT /db_xref="PDB:1KG0" FT /db_xref="PDB:1KLG" FT /db_xref="PDB:1KLU" FT /db_xref="PDB:1LO5" FT /db_xref="PDB:1PYW" FT /db_xref="PDB:1R5I" FT /db_xref="PDB:1SEB" FT /db_xref="PDB:1SJE" FT /db_xref="PDB:1SJH" FT /db_xref="PDB:1T5W" FT /db_xref="PDB:1T5X" FT /db_xref="PDB:2FSE" FT /db_xref="PDB:2G9H" FT /db_xref="PDB:2IAM" FT /db_xref="PDB:2IAN" FT /db_xref="PDB:2ICW" FT /db_xref="PDB:2IPK" FT /db_xref="PDB:2OJE" FT /db_xref="PDB:2XN9" FT /db_xref="PDB:3L6F" FT /db_xref="PDB:3PDO" FT /db_xref="PDB:3PGC" FT /db_xref="PDB:3PGD" FT /db_xref="PDB:3QXA" FT /db_xref="PDB:3QXD" FT /db_xref="PDB:3S4S" FT /db_xref="PDB:3S5L" FT /db_xref="PDB:4AEN" FT /db_xref="PDB:4AH2" FT /db_xref="PDB:4C56" FT /db_xref="PDB:4E41" FT /db_xref="PDB:4FQX" FT /db_xref="PDB:4GBX" FT /db_xref="PDB:4I5B" FT /db_xref="PDB:4OV5" FT /db_xref="PDB:4X5W" FT /db_xref="PDB:4X5X" FT /db_xref="PDB:6CQJ" FT /db_xref="PDB:6CQR" FT /db_xref="UniProtKB/Swiss-Prot:P04229" FT /protein_id="CAC27123.1" FT /translation="RFLWELKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAV FT TELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRR" XX SQ Sequence 270 BP; 58 A; 61 C; 100 G; 51 T; 0 other; cacgtttctt gtgggagctt aagtttgaat gtcatttctt caatgggacg gagcgggtgc 60 ggttgctgga aagatgcatc tataaccaag aggagtccgt gcgcttcgac agcgacgtgg 120 gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga 180 aggacctcct ggagcagagg cgggccgcgg tggacaccta ctgcagacac aactacgggg 240 ttggtgagag cttcacagtg cagcggcgag 270 //