Dbfetch

ID   AJ272045; SV 1; linear; mRNA; STD; MUS; 984 BP.
XX
AC   AJ272045;
XX
DT   04-APR-2000 (Rel. 63, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus mRNA for calcium channel gamma 4 subunit (CACNG4 gene)
XX
KW   CACNG4 gene; calcium channel gamma 4 subunit.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-984
RA   Klugbauer N.;
RT   ;
RL   Submitted (08-FEB-2000) to the INSDC.
RL   Klugbauer N., Institut fuer Pharmakologie und Toxikologie, Technische
RL   Universitaet Muenchen, Biedersteiner Str. 29, 81827 Muenchen, GERMANY.
XX
RN   [3]
RX   DOI; 10.1016/S0014-5793(00)01306-5.
RX   PUBMED; 10734232.
RA   Klugbauer N., Dai S., Specht V., Lacinova L., Marais E., Bohn G.,
RA   Hofmann F.;
RT   "A family of gamma-like calcium channel subunits";
RL   FEBS Lett. 470(2):189-197(2000).
XX
DR   MD5; e649f0b31b36ceb73d45aea653464ca7.
DR   Ensembl-Gn; ENSMUSG00000020723; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019323; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0019291; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0019260; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019265; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019074; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019715; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018627; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0019043; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0019155; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0019146; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0019225; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019176; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019752; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018392; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018678; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000021066; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0033168; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0033116; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0033101; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0033105; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0032891; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033604; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032732; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0032799; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0032951; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0032934; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0033070; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0032934; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033641; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0032425; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0032355; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..984
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:10090"
FT   CDS             1..984
FT                   /gene="CACNG4"
FT                   /product="calcium channel gamma 4 subunit"
FT                   /db_xref="GOA:Q9JJV4"
FT                   /db_xref="InterPro:IPR004031"
FT                   /db_xref="InterPro:IPR005423"
FT                   /db_xref="InterPro:IPR008368"
FT                   /db_xref="MGI:MGI:1859167"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JJV4"
FT                   /protein_id="CAB86386.1"
FT                   /translation="MVRCDRGLQMLLTTAGAFAAFSLMAIAIGTDYWLYSSAHICNGTN
FT                   LTMDDGPPPRRARGDLTHSGLWRVCCIEGIYRGHCFRINHFPEDNDYDHDSSEYLLRIV
FT                   RASSVFPILSTILLLLGGLCIGAGRIYSRKNNIVLSAGILFVAAGLSNIIGIIVYISSN
FT                   TGDPSDKRDEDKKNHYNYGWSFYFGALSFIVAETVGVLAVNIYIEKNKELRFKTKREFL
FT                   KASSSSPYARMPSYRYRRRRSRSSSRSTEASPSRDASPVGLKITGAIPMGELSMYTLSR
FT                   EPLKVTTAASYSPDQDAGFLQMHDFFQQDLKEGFHVSMLNRRTTPV"
XX
SQ   Sequence 984 BP; 211 A; 309 C; 261 G; 203 T; 0 other;
     atggtgcgat gcgaccgcgg gctgcagatg ctgctgacca cggccggagc cttcgccgcc        60
     ttctcgctca tggccatcgc catcggcacc gactactggc tgtactccag cgcgcacatc       120
     tgcaacggca ccaacctgac catggacgac gggcccccgc cccgccgcgc tcgcggcgac       180
     ctcacccatt cgggactctg gcgggtgtgt tgcatcgaag gcatctatag agggcactgc       240
     ttccggatca accacttccc agaggacaat gattacgacc acgacagctc cgagtacctc       300
     ctccgcattg tgcgagcctc cagtgtcttt cccatcctca gcaccattct gctcctgctc       360
     ggagggctct gcatcggcgc tgggaggatc tacagccgca agaacaatat tgtcctcagc       420
     gcgggaatcc tctttgtggc ggcaggcctc agtaatatca tcggtatcat cgtctacatt       480
     tccagcaaca cgggcgaccc cagtgacaaa cgtgacgaag acaaaaagaa ccattacaac       540
     tacggctggt ctttttactt tggagccctg tcgtttattg tggcggagac cgtgggcgtc       600
     ctggctgtaa acatttacat tgagaaaaat aaagagttga ggtttaagac caagcgggag       660
     ttccttaagg cctcttcctc ctctccttac gccaggatgc cgagctacag gtaccggcga       720
     cggcggtcca ggtccagttc aaggtccacg gaggcctcac cctccaggga tgcatctccc       780
     gtgggcctga agatcaccgg agccattccc atgggtgagc tgtccatgta cacgctatcc       840
     agagaacccc ttaaggtgac cacagctgcg agctacagtc cggaccagga cgctggcttc       900
     ctgcagatgc atgacttctt ccaacaggac ctaaaggaag gtttccatgt cagcatgctg       960
     aaccggcgga cgactcccgt gtga                                              984
//