Dbfetch

ID   AJ272044; SV 1; linear; mRNA; STD; MUS; 948 BP.
XX
AC   AJ272044;
XX
DT   04-APR-2000 (Rel. 63, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus mRNA for calcium channel gamma 3 subunit (CACNG3 gene)
XX
KW   CACNG3 gene; calcium channel gamma 3 subunit.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-948
RA   Klugbauer N.;
RT   ;
RL   Submitted (08-FEB-2000) to the INSDC.
RL   Klugbauer N., Institut fuer Pharmakologie und Toxikologie, Technische
RL   Universitaet Muenchen, Biedersteiner Str. 29, 81827 Muenchen, GERMANY.
XX
RN   [2]
RX   DOI; 10.1016/S0014-5793(00)01306-5.
RX   PUBMED; 10734232.
RA   Klugbauer N., Dai S., Specht V., Lacinova L., Marais E., Bohn G.,
RA   Hofmann F.;
RT   "A family of gamma-like calcium channel subunits";
RL   FEBS Lett. 470(2):189-197(2000).
XX
DR   MD5; dd6d813ac4b90415f4b8839871a32f03.
DR   Ensembl-Gn; ENSMUSG00000066189; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032957; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0032940; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0032872; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032945; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032655; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0033451; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031983; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0032628; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0032780; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0032733; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0032874; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032765; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0033471; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031691; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032096; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000084615; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0086314; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0086397; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0086337; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0086359; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0085921; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0086853; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0086441; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0085860; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0086057; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0085900; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0086092; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0085941; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0087147; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0085852; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0084963; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..948
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:10090"
FT   CDS             1..948
FT                   /gene="CACNG3"
FT                   /product="calcium channel gamma 3 subunit"
FT                   /db_xref="GOA:Q9JJV5"
FT                   /db_xref="InterPro:IPR004031"
FT                   /db_xref="InterPro:IPR008368"
FT                   /db_xref="MGI:MGI:1859165"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JJV5"
FT                   /protein_id="CAB86385.1"
FT                   /translation="MRMCDRGIQMLITTVGAFAAFSLMTIAVGTDYWLYSRGVCRTKST
FT                   SDNETSRKNEEVMTHFGLWRTCCLEGAFRGVCKKIDHFPEDADYEQDTAEYLLRAVRAS
FT                   SVFPILSVTLLFFGGLCVAASEFHRSRHSVILSAGIFFVSAGLSNIIGIIVYISANAGD
FT                   PGQRDSKKSYSYGWSFYFGAFSFIIAEIVGVVAVHIYIEKHQQLRARSHSELLKKSTFA
FT                   RLPPYRYRFRRRSSSRSTEPRSRDLSPISKGFHTIPSTDISMFTLSRDPSKLTMGTLLN
FT                   SDRDHAFLQFHNSTPKEFKESLHNNPANRRTTPV"
XX
SQ   Sequence 948 BP; 230 A; 268 C; 223 G; 227 T; 0 other;
     atgaggatgt gtgacagagg tatccagatg ttgatcacta ctgtaggagc cttcgcagct        60
     tttagtttaa tgaccattgc agtgggcacg gactactggc tatattccag aggtgtgtgc       120
     aggactaaat ctacaagtga caatgaaacc agcaggaaga atgaagaagt aatgacccac       180
     ttcgggttgt ggaggacctg ctgcttggaa ggagctttcc gaggcgtgtg caagaaaatc       240
     gatcacttcc cagaagatgc agactatgaa caggatacag cagaatatct tctacgagct       300
     gtgagggcct ccagcgtctt tcccatcctc agcgtcactc tgctgttttt cgggggactc       360
     tgcgtggctg ccagcgagtt ccaccgcagc aggcacagtg tgatcctcag cgctggcatc       420
     ttcttcgtct ctgcagggct aagcaacatc atcggcatca tagtttatat ctcagccaat       480
     gctggagacc ctgggcagag ggactctaaa aagagctact cctacggctg gtccttttat       540
     tttggagcct tctctttcat catcgcggaa attgtgggcg tggtcgccgt gcacatctat       600
     atcgagaagc atcagcagtt gcgtgccaga tcccattcag agctcctgaa gaagtctaca       660
     tttgcgcgcc tgccgcccta caggtataga ttccgaagac ggtcaagttc tcgctccact       720
     gaacccagat ctcgagacct ttctcccatc agcaaaggct tccacaccat cccttccacc       780
     gacatctcca tgttcaccct ctcccgggac ccctctaagc ttaccatggg gacccttctc       840
     aactctgacc gggaccatgc ttttctacag ttccacaact ccacacccaa agagttcaaa       900
     gagtcattgc ataacaatcc ggccaacaga cgcaccacgc ccgtctga                    948
//