Dbfetch

ID   AJ271092; SV 2; linear; mRNA; STD; MUS; 4032 BP.
XX
AC   AJ271092;
XX
DT   14-JUN-2000 (Rel. 64, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus mRNA for Ltrcp5 protein (Ltrpc5 gene), alternative variant 1
XX
KW   alternative splicing; Ltrpc5 gene; Ltrpc5 protein.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RC   Revised by [4]
RA   Stroedicke M.;
RT   ;
RL   Submitted (14-JAN-2000) to the INSDC.
RL   Stroedicke M., T.A.Trautner, Max-Planck-Institut fuer Molekulare Genetik,
RL   Ihnestrasse 73, 14195 Berlin, GERMANY.
XX
RN   [3]
RX   DOI; 10.1093/hmg/9.12.1829.
RX   PUBMED; 10915772.
RA   Paulsen M., El-Maarri O., Engemann S., Stroedicke M., Franck O., Davies K.,
RA   Reinhardt R., Reik W., Walter J.;
RT   "Sequence conservation and variability of imprinting in the
RT   Beckwith-Wiedemann syndrome gene cluster in human and mouse";
RL   Hum. Mol. Genet. 9(12):1829-1841(2000).
XX
RN   [4]
RP   1-4032
RA   Engemann S.;
RT   ;
RL   Submitted (18-JAN-2001) to the INSDC.
RL   Engemann S., T.A.Trautner, Max-Planck-Institut fuer Molekulare Genetik,
RL   Ihnestrasse 73, 14195 Berlin, GERMANY.
XX
DR   MD5; bc1b042ce42c856986df72b46cfa1fc0.
DR   Ensembl-Gn; ENSMUSG00000009246; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000009390; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000150867; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4032
FT                   /organism="Mus musculus"
FT                   /chromosome="7"
FT                   /sub_species="domesticus"
FT                   /strain="129 SV"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             1..3447
FT                   /gene="Ltrpc5"
FT                   /product="Ltrpc5 protein"
FT                   /function="TRP channel"
FT                   /note="alternative variant 1"
FT                   /db_xref="GOA:Q9JJH7"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR029577"
FT                   /db_xref="MGI:MGI:1861718"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JJH7"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="CAB94717.2"
FT                   /translation="MQTTQSSCPGSPPDTEDGWEPILCRGEINFGGSGKKRGKFVKVPS
FT                   SVAPSVLFELLLTEWHLPAPNLVVSLVGEERPLAMKSWLRDVLRKGLVKAAQSTGAWIL
FT                   TSALHVGLARHVGQAVRDHSLASTSTKIRVVAIGMASLDRILHRQLLDGVHQKEDTPIH
FT                   YPADEGNIQGPLCPLDSNLSHFILVESGALGSGNDGLTELQLSLEKHISQQRTGYGGTS
FT                   CIQIPVLCLLVNGDPNTLERISRAVEQAAPWLILAGSGGIADVLAALVSQPHLLVPQVA
FT                   EKQFREKFPSECFSWEAIVHWTELLQNIAAHPHLLTVYDFEQEGSEDLDTVILKALVKA
FT                   CKSHSQEAQDYLDELKLAVAWDRVDIAKSEIFNGDVEWKSCDLEEVMTDALVSNKPDFV
FT                   RLFVDSGADMAEFLTYGRLQQLYHSVSPKSLLFELLQRKHEEGRLTLAGLGAQQARELP
FT                   IGLPAFSLHEVSRVLKDFLHDACRGFYQDGRRMEERGPPKRPAGQKWLPDLSRKSEDPW
FT                   RDLFLWAVLQNRYEMATYFWAMGREGVAAALAACKIIKEMSHLEKEAEVARTMREAKYE
FT                   QLALDLFSECYGNSEDRAFALLVRRNHSWSRTTCLPLATEADAKAFFAHDGVQAFLTKI
FT                   WWGDMATGTPILRLLGAFTCPALIYTNLISFSEDAPQRMDLEDLQEPDSLDMEKSFLCS
FT                   RGGQLEKLTEAPRAPGDLGPQAAFLLTRWRKFWGAPVTVFLGNVVMYFAFLFLFTYVLL
FT                   VDFRPPPQGPSGSEVTLYFWVFTLVLEEIRQGFFTDEDTHLVKKFTLYVEDNWNKCDMV
FT                   AIFLFIVGVTCRMVPSVFEAGRTVLAIDFMVFTLRLIHIFAIHKQLGPKIIIVERMMKD
FT                   VFFFLFFLSVWLVAYGVTTQALLHPHDGRLEWIFRRVLYRPYLQIFGQIPLDEIDEARV
FT                   NCSLHPLLLESSASCPNLYANWLVILLLVTFLLVTNVLLMNLLIAMFSYTFQVVQGNAD
FT                   MFWKFQRYHLIVEYHGRPALAPPFILLSHLSLVLKQVFRKEAQHKRQHLERDLPDPLDQ
FT                   KIITWETVQKENFLSTMEKRRRDSEGEVLRKTAHRVDLIAKYIGGLREQEKRIKCLESQ
FT                   ANYCMLLLSSMTDTLAPGGTYSALRTVVAGVSQPLLETGST"
XX
SQ   Sequence 4032 BP; 890 A; 1129 C; 1095 G; 918 T; 0 other;
     atgcaaacaa cccagagctc ctgccccggc agccccccag atactgagga tggctgggag        60
     cccatcctat gcaggggaga gatcaacttc ggagggtctg ggaagaagcg aggcaagttt       120
     gtgaaggtgc caagcagtgt ggccccctcc gtgctttttg aactcctgct caccgagtgg       180
     cacctgccag cccccaacct ggtggtgtcc ctggtgggtg aggaacgacc tttggctatg       240
     aagtcgtggc ttcgggatgt cctgcgcaag gggctggtga aagcagctca gagcacaggt       300
     gcctggatcc tgaccagtgc cctccacgtg ggcctggccc gccatgttgg acaagctgta       360
     cgtgatcact ctctggctag cacatccacc aagatccgtg tagtggccat cggaatggcc       420
     tctctggatc gaatccttca ccgtcaactt ctagatggtg tccaccaaaa ggaggatact       480
     cccatccact acccagcaga tgagggcaac attcagggac ccctctgccc cctggacagc       540
     aatctctccc acttcatcct tgtggagtca ggcgcccttg ggagtgggaa cgacgggctg       600
     acagagctgc agctgagcct ggagaagcac atctctcagc agaggacagg ttatgggggc       660
     accagctgca tccagatacc tgtcctttgc ctgttggtca atggtgaccc caacacccta       720
     gagaggattt ccagggcagt ggagcaggct gccccatggc tgatcctggc aggttctggt       780
     ggcattgctg atgtactcgc tgccctggtg agccagcctc atctcctggt gccccaggtg       840
     gctgagaagc agttcagaga gaaattcccc agcgagtgtt tctcttggga agccattgta       900
     cactggacag agctgttaca gaacattgct gcacaccccc acctgctcac agtatatgac       960
     ttcgagcagg agggttcgga ggacctggac actgtcatcc tcaaggcact tgtgaaagcc      1020
     tgcaagagcc acagccaaga agcccaagac tacctagatg agctcaagtt agcagtggcc      1080
     tgggatcgcg tggacattgc caagagtgaa atcttcaatg gggacgtgga atggaagtcc      1140
     tgtgacttgg aagaggtgat gacagatgcc ctcgtgagca acaagcctga ctttgtccgc      1200
     ctctttgtgg acagcggtgc tgacatggcc gagttcttga cctatgggcg gctgcagcag      1260
     ctttaccatt ctgtgtcccc caagagcctc ctctttgaac tgctgcagcg taagcatgag      1320
     gagggtaggc tgacactggc cggcctgggt gcccagcagg ctcgggagct gcccattggt      1380
     ctgcctgcct tctcactcca cgaggtctcc cgcgtactca aagacttcct gcatgacgcc      1440
     tgccgtggct tctaccagga cgggcgcagg atggaggaga gagggccacc taagcggccc      1500
     gcaggccaga agtggctgcc agacctcagt aggaagagtg aagacccttg gagggacctg      1560
     ttcctctggg ctgtgctgca gaatcgttat gagatggcca catacttctg ggccatgggc      1620
     cgggagggtg tggctgctgc tctggctgcc tgcaagatca taaaggaaat gtcccacctg      1680
     gagaaagagg cagaggtggc ccgcaccatg cgtgaggcca agtatgagca gctggccctg      1740
     gatcttttct cagagtgcta cggcaacagt gaggaccgtg cctttgccct gctggtgcga      1800
     aggaaccaca gctggagcag gaccacgtgc ctgcccttgg ccactgaagc tgatgccaag      1860
     gccttctttg cccatgacgg tgtgcaagca ttcctgacca agatctggtg gggagacatg      1920
     gccacaggca cacccatcct acggcttctg ggtgccttca cctgcccagc cctcatctac      1980
     acaaacctca tctccttcag tgaggatgcc ccgcagagga tggacctaga agatctgcag      2040
     gagccagaca gcttggatat ggaaaagagc ttcctatgca gccggggtgg ccaattggag      2100
     aagctaacag aggcaccaag ggctccaggc gatctaggcc cacaagctgc cttcctgctc      2160
     acacggtgga ggaagttctg gggcgctcct gtgactgtgt tcctggggaa tgtggtcatg      2220
     tacttcgcat tcctcttcct gttcacctat gtcctgctgg tggacttcag gccaccaccc      2280
     caggggccgt ctggatccga ggttaccctc tatttctggg tgttcacact ggtgctggag      2340
     gaaatccgac agggcttctt cacagatgag gacacgcacc tggtgaagaa attcactctg      2400
     tatgtggaag acaactggaa caagtgtgac atggtggcca tcttcctgtt cattgtggga      2460
     gtcacctgta gaatggtgcc ctcggtgttt gaggctggca ggaccgttct ggccattgac      2520
     ttcatggtgt tcacacttcg gctcatccac atctttgcta ttcacaagca gttgggtcct      2580
     aagatcatca ttgtagagcg aatgatgaag gatgtcttct ttttcctctt cttcctgagc      2640
     gtatggcttg tggcctatgg tgtgaccact caggccctgc tgcatcccca tgatggccgt      2700
     ttggagtgga ttttccgccg tgtgctatac aggccttacc tgcagatctt tgggcaaatc      2760
     cctctggatg aaattgatga ggctcgtgtg aactgttctc ttcaccctct gctgctggaa      2820
     agctcggctt cctgccctaa tctctatgcc aactggctgg tcattctcct gctggttacc      2880
     ttcctgcttg tcactaatgt gctgctcatg aaccttctga tcgccatgtt cagctacaca      2940
     ttccaggtgg tgcaaggcaa tgcagacatg ttctggaagt ttcaacgcta ccacctcatc      3000
     gttgaatacc atggaagacc agctctggcc ccgcccttca tcctgctcag ccacctgagc      3060
     ctggtgctca agcaggtctt caggaaggaa gcccagcata agcgacaaca tctggagaga      3120
     gacttgcctg accccttgga ccagaagatc attacctggg aaacggttca aaaggagaac      3180
     ttcctgagta ccatggagaa acggaggagg gacagcgagg gggaggtgct gaggaaaacg      3240
     gcacacagag tggacttgat tgccaaatac atcggggggc tgagagagca agaaaagagg      3300
     atcaagtgtc tggaatcaca ggccaactac tgtatgctcc tcttgtcctc tatgacggat      3360
     acactggctc caggaggcac ctactcagct ctcagaactg tggttgcagg agtcagccag      3420
     cctctgctag agacagggag tacctagagt ctggcttgcc accctctgac acctgaaatg      3480
     gagaaaccac ttgctctaga gccccagacc tggccacatc gagtttttgg ggcacatcaa      3540
     ccttccccca ctcccagcag ccccaagaaa tggtcttcaa ggccttgcta cagatcactt      3600
     cttggacatc ccttcctaag agaatgaaac tcatgtcttt ggcatctatt cgggagcctc      3660
     agaagtatcc tctccagcag ggcaagattt ttcatgtccc actaaagctt tcactggctt      3720
     ggactggaca gctggatctg gccaagtcct acataggaca ccatctgcct ggatggggct      3780
     atttaggtct aacccctgtc ttaccctgag ttcctaagaa gccaacctct taaacactag      3840
     gtttctttct gacccctgac ccactcatta gctgaccagc tcctagaggg caggactcag      3900
     atctattgta attacctccc atctttcacc ccccacagca ttatctgtct gatcattctg      3960
     gcagaaaccc caagatattg ctcaagggta cccaatgcta ctttactttc tataaagcct      4020
     gtagaccacc tc                                                          4032
//