Dbfetch

ID   AJ251985; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ251985;
XX
DT   19-DEC-2000 (Rel. 66, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens HLA-DRB1 gene for MHC class II antigen, DRB1*1309new allele,
DE   exon 2
XX
KW   HLA-DRB1 gene; human leucocyte antigen DRB1; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   Revised by author 19-MAY-2000
RP   1-270
RA   Wu S.;
RT   ;
RL   Submitted (17-DEC-1999) to the INSDC.
RL   Wu S., Medical Technology, Tzu Chi College of Medicine and Humanities,
RL   #701, Chung Yang Rd., Section III, Hualien, 970, TAIWAN.
XX
RN   [2]
RX   DOI; 10.1034/j.1399-0039.2001.057004384.x.
RX   PUBMED; 11380954.
RA   Wu S., Shiao Y.M., Lai C.Y., Lai S.M., Chen S.P., Sidebottom D.A.,
RA   Hildebrand W.H., Tilanus M.G.J., Chou F.C., Tsai M.F.;
RT   "Polymorphism of human HLA-DRB1 antigens generated by genetic exchange
RT   between DR2 (DRB1*15011) and DR6 (DRB1*1405) alleles: a novel DRB1 allele
RT   (DRB1*1437) identified in a Paiwan tribe member of Taiwan";
RL   Tissue Antigens 57(4):384-387(2001).
XX
DR   MD5; 91c025b68539b7230f603a5a5162d75b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p"
FT                   /mol_type="genomic DNA"
FT                   /country="Taiwan"
FT                   /clone="P43"
FT                   /cell_type="leucocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /note="DRB1*1309new allele"
FT                   /db_xref="GOA:Q9GIY3"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*14:37"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9GIY3"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="CAC19086.1"
FT                   /translation="RFLEYSTSECQFFNGTERVRFLDRYFHNQEEFVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT                   /note="DRB1*1309new allele"
XX
SQ   Sequence 270 BP; 56 A; 65 C; 98 G; 51 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcaattctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc cataaccagg aggagttcgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc tgagtactgg aacagccaga       180
     aggacatcct ggagcaggcg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//