Dbfetch

ID   AJ251113; SV 1; linear; mRNA; STD; MUS; 1932 BP.
XX
AC   AJ251113;
XX
DT   17-JUN-2001 (Rel. 68, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus mRNA for fatty acid transport protein 4 (FATP4 gene)
XX
KW   FATP4 gene; fatty acid transport protein 4.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1932
RA   Herrmann T.;
RT   ;
RL   Submitted (22-NOV-1999) to the INSDC.
RL   Herrmann T., Department of Internal Medicine IV, University Hospital of
RL   Heidelberg, Bergheimer Str. 58, Heidelberg, 69115, GERMANY.
XX
RN   [3]
RX   DOI; 10.1016/S0378-1119(01)00489-9.
RX   PUBMED; 11404000.
RA   Herrmann T., Buchkremer F., Gosch I., Hall A.M., Bernlohr D.A.,
RA   Stremmel W.;
RT   "Mouse fatty acid transport protein 4 (FATP4): characterization of the gene
RT   and functional assessment as a very long chain acyl-CoA synthetase";
RL   Gene 270(1-2):31-40(2001).
XX
DR   MD5; f615d23f88a1537e8a941627ab1a9c3c.
DR   Ensembl-Gn; ENSMUSG00000059316; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025544; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0025522; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0025491; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025517; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025279; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025962; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024742; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0025256; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0025389; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0025352; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0025475; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025382; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026021; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024488; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024810; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000080065; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053664; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0053678; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0053632; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053621; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053356; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054113; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053522; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0053301; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0053410; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0053372; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0053518; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053357; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0054249; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053124; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052633; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1932
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             1..1932
FT                   /gene="FATP4"
FT                   /product="fatty acid transport protein 4"
FT                   /db_xref="GOA:Q91VE0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR022272"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR030304"
FT                   /db_xref="MGI:MGI:1347347"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q91VE0"
FT                   /protein_id="CAC42082.1"
FT                   /translation="MLLGASLVGALLFSKLVLKLPWTQVGFSLLLLYLGSGGWRFIRVF
FT                   IKTVRRDIFGGMVLLKVKTKVRRYLQERKTVPLLFASMVQRHPDKTALIFEGTDTHWTF
FT                   RQLDEYSSSVANFLQARGLASGNVVALFMENRNEFVGLWLGMAKLGVEAALINTNLRRD
FT                   ALRHCLDTSKARALIFGSEMASAICEIHASLEPTLSLFCSGSWEPSTVPVSTEHLDPLL
FT                   EDAPKHLPSHPDKGFTDKLFYIYTSGTTGLPKAAIVVHSRYYRMASLVYYGFRMRPDDI
FT                   VYDCLPLYHSAGNIVGIGQCLLHGMTVVIRKKFSASRFWDDCIKYNCTIVQYIGELCRY
FT                   LLNQPPREAESRHKVRMALGNGLRQSIWTDFSSRFHIPQVAEFYGATECNCSLGNFDSR
FT                   VGACGFNSRILSFVYPIRLVRVNEDTMELIRGPDGVCIPCQPGQPGQLVGRIIQQDPLR
FT                   RFDGYLNQGANNKKIANDVFKKGDQAYLTGDVLVMDELGYLYFRDRTGDTFRWKGENVS
FT                   TTEVEGTLSRLLHMADVAVYGVEVPGTEGRAGMAAVASPISNCDLESFAQTLKKELPLY
FT                   ARPIFLRFLPELHKTGTFKFQKTELRKEGFDPSVVKDPLFYLDARKGCYVALDQEAYTR
FT                   IQAGEEKL"
XX
SQ   Sequence 1932 BP; 398 A; 542 C; 555 G; 437 T; 0 other;
     atgctacttg gagcatctct ggtgggggcg ctactgttct ccaagctagt gctgaagctg        60
     ccctggaccc aggtgggatt ctccctgttg ctcctgtact tggggtctgg tggctggcgt       120
     ttcatccggg tcttcatcaa gacggtcagg agagatatct ttggtggcat ggtgctcctg       180
     aaggtgaaga ccaaggtgcg acggtacctt caggagcgga agacggtgcc cctgctgttt       240
     gcttcaatgg tacagcgcca cccggacaag acagccctga ttttcgaggg cacagacact       300
     cactggacct tccgccagct ggatgagtac tccagtagtg tggccaactt cctgcaggcc       360
     cggggcctgg cctcaggcaa tgtagttgcc ctctttatgg aaaaccgcaa tgagtttgtg       420
     ggtctgtggc taggcatggc caagctgggc gtggaggcgg ctctcatcaa caccaacctt       480
     aggcgggatg ccctgcgcca ctgtcttgac acctcaaagg cacgagctct catctttggc       540
     agtgagatgg cctcagctat ctgtgagatc catgctagcc tggagcccac actcagcctc       600
     ttctgctctg gatcctggga gcccagcaca gtgcccgtca gcacagagca tctggaccct       660
     cttctggaag atgccccgaa gcacctgccc agtcacccag acaagggttt tacagataag       720
     ctcttctaca tctacacatc gggcaccacg gggctaccca aagctgccat tgtggtgcac       780
     agcaggtatt atcgtatggc ttccctggtg tactatggat tccgcatgcg gcctgatgac       840
     attgtctatg actgcctccc cctctaccac tcagcaggaa acatcgtggg gattggccag       900
     tgcttactcc acggcatgac tgtggtgatc cggaagaagt tctcagcctc ccggttctgg       960
     gatgattgta tcaagtacaa ctgcacaatt gtacagtaca ttggcgagct ctgccgctac      1020
     ctcctgaacc agccaccccg tgaggctgag tctcggcaca aggtgcgcat ggcactgggc      1080
     aacggtctcc ggcagtccat ctggaccgac ttctccagcc gtttccacat cccccaggtg      1140
     gctgagttct atggggccac tgaatgcaac tgtagcctgg gcaactttga cagccgggtg      1200
     ggggcctgtg gcttcaatag ccgcatcctg tcctttgtgt accctatccg tttggtacgt      1260
     gtcaatgagg ataccatgga actgatccgg ggacccgatg gagtctgcat tccctgtcaa      1320
     ccaggtcagc caggccagct ggtgggtcgc atcatccagc aggaccctct gcgccgtttc      1380
     gacgggtacc tcaaccaggg tgccaacaac aagaagattg ctaatgatgt cttcaagaag      1440
     ggggaccaag cctacctcac tggtgacgtc ctggtgatgg atgagctggg ttacctgtac      1500
     ttccgagatc gcactgggga cacgttccgc tggaaagggg agaatgtgtc taccactgag      1560
     gtggagggca cactcagccg cctgcttcat atggcagatg tggcagttta tggtgttgag      1620
     gtgccaggaa ctgaaggccg agcaggaatg gctgccgttg caagtcccat cagcaactgt      1680
     gacctggaga gctttgcaca gaccttgaaa aaggagctgc ctctgtatgc ccgccccatc      1740
     ttcctgcgct tcttgcctga gctgcacaag acagggacct tcaagttcca gaagacagag      1800
     ttgcggaagg agggctttga cccatctgtt gtgaaagacc cgctgttcta tctggatgct      1860
     cggaagggct gctacgttgc actggaccag gaggcctata cccgcatcca ggcaggcgag      1920
     gagaagctgt ga                                                          1932
//