spacer

EBI Dbfetch

ID   AJ250723; SV 1; linear; mRNA; STD; MUS; 2942 BP.
XX
AC   AJ250723;
XX
DT   29-OCT-1999 (Rel. 61, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus mRNA for septin-like protein Sint1 (Sint1 gene)
XX
KW   septin-like protein; Sint1 gene; Sint1 protein.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2942
RA   Sorensen A.B.;
RT   ;
RL   Submitted (28-OCT-1999) to the INSDC.
RL   Sorensen A.B., Department of Molecular and Structural Biology, University
RL   of Aarhus, C. F. Moellers Alle, Bldg. 130, DK-8000 Aarhus C, DENMARK.
XX
RN   [2]
RX   DOI; 10.1128/JVI.74.5.2161-2168.2000.
RX   PUBMED; 10666245.
RA   Sorensen A.B., Lund A.H., Ethelberg S., Copeland N.G., Jenkins N.A.,
RA   Pedersen F.S.;
RT   "Sint1, a common integration site in SL3-3-induced T-cell lymphomas,
RT   harbors a putative proto-oncogene with homology to the septin gene family";
RL   J. Virol. 74(5):2161-2168(2000).
XX
DR   MD5; 7f42391ddc8fdd3ef788542b69d370e7.
DR   Ensembl-Gn; ENSMUSG00000059248; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000019038; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000093907; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000100193; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106349; mus_musculus.
DR   EuropePMC; PMC111696; 10666245.
DR   EuropePMC; PMC138619; 12475938.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2942
FT                   /organism="Mus musculus"
FT                   /chromosome="11"
FT                   /mol_type="mRNA"
FT                   /dev_stage="embryo, 16.5 days"
FT                   /db_xref="taxon:10090"
FT   CDS             178..1182
FT                   /gene="Sint1"
FT                   /product="septin-like protein Sint1"
FT                   /function="putative proto-oncogene"
FT                   /db_xref="GOA:Q80UG5"
FT                   /db_xref="InterPro:IPR000038"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1858222"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q80UG5"
FT                   /protein_id="CAB59833.1"
FT                   /translation="MADNPRDAMLKQAPASRNEKAPMEFGYVGIDSILEQMRRKAMKQG
FT                   FEFNIMVVGQSGLGKSTLINTLFKSKISRKSVQPTSEERIPKTIEIKSITHDIEEKGVR
FT                   MKLTVIDTPGFGDHINNENCWQPIMKFINDQYEKYLQEEVNINRKKRIPDTRVHCCLYF
FT                   IPATGHSLRPLDIEFMKRLSKVVNIVPVIAKADTLTLEERVYFKQRITADLLSNGIDVY
FT                   PQKEFDEDAEDRLVNEKFREMIPFAVVGSDHEYQVNGKRILGRKTKWGTIEVENTTHCE
FT                   FAYLRDLLIRTHMQNIKDITSNIHFEAYRVKRLNEGNSAMANGIEKEPEAQEM"
FT   polyA_signal    2918..2923
FT                   /gene="Sint1"
XX
SQ   Sequence 2942 BP; 702 A; 837 C; 780 G; 623 T; 0 other;
     aattcggcac gaggcgccag aacacaaccg gagtccctga ggctccagaa cagagtcagg        60
     gtgagccagc cccagcccag ccccaggttc tggcttcctc tcttgcttct ccctcctttg       120
     gttgcagcca gcagagccca cttaaactcc gaggtgactc ccagctgtgt tggcgacatg       180
     gctgacaacc ctagagatgc catgctcaag caggcccccg cgtcacggaa cgaaaaggcc       240
     cccatggagt tcggctatgt ggggatcgac tccatcctgg agcagatgcg caggaaggct       300
     atgaaacagg gcttcgagtt taacatcatg gtggttgggc agagcggcct cgggaagtcc       360
     actttaatca ataccctctt caagtccaaa atcagccgga agtcggtgca gcccacctcg       420
     gaggaacgca tccccaagac gatcgaaatc aagtcgatca cccacgatat tgaagagaag       480
     ggggttcgaa tgaagctgac agtgattgac acgccgggct tcggagacca catcaacaat       540
     gagaactgct ggcagcccat tatgaagttc atcaatgacc aatatgagaa gtacctgcag       600
     gaggaagtca acatcaaccg gaagaagcgc attcccgaca cccgtgtcca ctgctgcctc       660
     tacttcatcc cagccaccgg ccactcgctc aggcccctgg acattgaatt catgaagcgc       720
     ctaagcaaag tggtgaacat tgtcccagtc atcgccaagg ctgacacgct gaccctggag       780
     gagagggtct acttcaaaca gcggatcact gcagacctgc tgtccaacgg cattgacgtg       840
     tacccgcaga aggagtttga tgaggacgca gaagaccggc tggtgaacga aaagttccgg       900
     gagatgatcc catttgctgt ggtgggcagc gaccatgagt atcaagtcaa tggcaagagg       960
     attctgggaa ggaagaccaa gtggggcact atcgaagttg agaataccac tcactgtgaa      1020
     tttgcttacc tgcgggatct ccttatcagg acgcacatgc aaaacatcaa agacatcacc      1080
     agcaacatcc acttcgaagc ctaccgagtg aaacgcctca acgagggcaa cagcgccatg      1140
     gccaacggga tcgagaagga gccggaagcc caggagatgt agatgcgtcc cgcccctgga      1200
     ccccaccccc agatcttttc atcatccctg gcccacccac ctaccctgtc ttattttata      1260
     taattatctc cttgtcacct gcctccatcc atctcttccc acactttgcc aggtaacaag      1320
     agagggttta cctcccaagt gtgctcttat tggctgcagc agcagggtgg gcggggctaa      1380
     gcctgggctt gcctctgtgc tctatttcca cccgggctca gcccctgagg ggttagaaga      1440
     gctatgtgtc cgtcccccgc tctgagttct aagctgaagc ctgtgggggc caagtcctag      1500
     ggggtgcaga ggagcccgtt agaccacaag accccatggc cgcagcctca agcaggttag      1560
     agactgcccc aaaggaggat ggagctggcc gggtattcct gaaacctcac ctgcccctcc      1620
     gggggcgttt cttacagcgc cctcagctgc ctgcccctca agggaactag aggcgtcaca      1680
     gccaaagttg ccaatcactt agacaaagtg acaaccgtgc ccctcgagct tgtcccagag      1740
     cagaaagtgc cttgatctac aagagccagt cacctcttcc cagatgtccc tttgggtgaa      1800
     aagcagggac gtgctggaga gagggaggta tcttttctcc ctcgcccttg ggttctctct      1860
     cccctgtgct gtagatatcg ctactacact gggctttaat tataaaagac gaagcgtgaa      1920
     agatgctccc cgatgttagg aagccccgcc cccaatgtaa ggaaggtcaa agcaagaaga      1980
     tgagtcgaag ccatgaggga ggaagccgtg gaagggaggc ataagagtgt gtgggagctc      2040
     tcctgcccag gtgccgcgga aggcatatcc gcgtggtcct cagtttgggc caagatattc      2100
     tggttacatt gatgctccgc tgcctcaccc tgtcccaccc cacacacccc aggctcaagc      2160
     cttgatgatt cagtgactgt actgggtggg agccagaaac ctgaccattt tgttgtctac      2220
     atgagcctag actagccctg tgccccagaa cccatcaaaa atacccctaa agagggaaag      2280
     atgagggggt cagagatgga tagccaggct cactcatctt ctctcagagg gaacattagg      2340
     gaccatccat gcacagctga ccaaagccgt gtccttcctg cctgcctccc attctcattt      2400
     gcccctgagg agaaagtttg gtgaggtgcg ttaggttgga cccgcttggg gaaggtgcct      2460
     ctacagaccc agggctagct ttctgcagcc cagaagtgca gtgggagggg tggggtgcag      2520
     acagatggag acgaacattg tttcctgctt tgggcgtcta ctccctcatc caagcatgga      2580
     agggcccctc gtcatgccct gtggccgaac agttcgcttg ccagcttgcc aagttctttg      2640
     ccaaaatcag gactttgaag gaaatctcca gcacgctgga cccagggcac tccggccttc      2700
     accagcccaa gtgaccctgg ggatttagca gcaacccggt catcaggatg actttgtgcc      2760
     tctgtaacca ggtattgaaa ctgttcgtct caccaggccg gtccacgtgg ccctctgctg      2820
     ggggcttcct ggtggggggg cagaaaagtc tctctctctc tctctctctc tttttttttt      2880
     tgtataaata acaaagtgtc tgaaatgtat ttcctgaaat aaatgtttca aatctcgtgc      2940
     cg                                                                     2942
//


spacer
spacer