Dbfetch

ID   AJ249591; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ249591;
XX
DT   30-SEP-1999 (Rel. 61, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, DRB1*13
DE   allele, exon 2
XX
KW   DRB1*13 allele; HLA-DRB1 gene; major histocompatibility complex;
KW   MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Bois M.M.;
RT   ;
RL   Submitted (30-SEP-1999) to the INSDC.
RL   Bois M.M., Molecular Biology-Histocompatibility, ETS Poitou-Charentes,
RL   BP482, 86012 Poitiers, FRANCE.
XX
RN   [2]
RA   Bois M., Dormoy A., Alcalay D.;
RT   "Caracterization of a new HLA-DRB1*13 class II allele";
RL   Unpublished.
XX
DR   MD5; 4bb53f88fb4f44c753a80e81a3a53817.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /country="Guadeloupe"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /standard_name="MHC class II antigen"
FT                   /product="human leucocyte antigen DRB1"
FT                   /note="DRB1*13 allele"
FT                   /db_xref="GOA:Q5Y7A7"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*13:41"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5Y7A7"
FT                   /protein_id="CAB56840.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRYLDRYFHNQEENVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDILEDERAAVDTYCRHNYGVGESFTVQRR"
FT   exon            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT                   /note="DRB1*13 allele"
XX
SQ   Sequence 270 BP; 59 A; 65 C; 97 G; 49 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggtacctgga cagatacttc cataaccagg aggagaacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacatcct ggaagacgag cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//