spacer

EBI Dbfetch

ID   AJ245904; SV 1; linear; mRNA; STD; MUS; 4702 BP.
XX
AC   AJ245904;
XX
DT   02-MAY-2000 (Rel. 63, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus mRNA for Shank3b protein (shank3 gene)
XX
KW   alternative splicing; shank3 gene; Shank3b protein.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4702
RA   Dehmelt L.;
RT   ;
RL   Submitted (08-SEP-1999) to the INSDC.
RL   Dehmelt L., Epithelphysiologie, Max-Planck-Institut fuer molekulare
RL   Physiologie, Otto-Hahn-Strasse 11, 44227 Dortmund, GERMANY.
XX
RN   [2]
RA   Dehmelt L., Nalbant P., Werner A.;
RT   "Interaction of the Na+/Phosphate Cotransporter Type II with rSHANK";
RL   Unpublished.
XX
DR   MD5; e52336e9c42a58597bd14070e2c9d48d.
DR   Ensembl-Gn; ENSMUSG00000022623; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066545; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4702
FT                   /organism="Mus musculus"
FT                   /strain="C57B1/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="8-weeks old"
FT                   /tissue_lib="Superscript Mouse Kidney cDNA Library"
FT                   /tissue_type="kidney"
FT                   /db_xref="taxon:10090"
FT   CDS             74..2203
FT                   /gene="shank3"
FT                   /product="Shank3b protein"
FT                   /function="interacts with the Na/Phosphate Cotransporter
FT                   via its PDZ domain"
FT                   /db_xref="GOA:Q4ACU6"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001660"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR011511"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR021129"
FT                   /db_xref="MGI:MGI:1930016"
FT                   /db_xref="PDB:3O5N"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ACU6"
FT                   /protein_id="CAB89816.1"
FT                   /translation="MGLCGSLLPTFSLSEQFRYKRRVYAQNLIDDKQFAKLHTKANLKK
FT                   FMDYVQLHSTDKVARLLDKGLDPNFHDPDSGECPLSLAAQLDNATDLLKVLRNGGAHLD
FT                   FRTRDGLTAVHCATRQRNAGALTTLLDLGASPDYKDSRGLTPLYHSALGGGDALCCELL
FT                   LHDHAQLGTTDENGWQEIHQACRFGHVQHLEHLLFYGANMGAQNASGNTALHICALYNQ
FT                   ESCARVLLFRGANKDVRNYNSQTAFQVAIIAGNFELAEVIKTHKDSDVVPFRETPSYAK
FT                   RRRLAGPSGLASPRPLQRSASDINLKGDQPAASPGPTLRSLPHQLLLQRLQEEKDRDRD
FT                   GELENDISGPSAGRGGHNKISPSGPGGSGPAPGPGPASPAPPAPPPRGPKRKLYSAVPG
FT                   RKFIAVKAHSPQGEGEIPLHRGEAVKVLSIGEGGFWEGTVKGRTGWFPADCVEEVQMRQ
FT                   YDTRHETREDRTKRLFRHYTVGSYDSLTSHSDYVIDDKVAILQKRDHEGFGFVLRGAKA
FT                   ETPIEEFTPTPAFPALQYLESVDVEGVAWRAGLRTGDFLIEVNGVNVVKVGHKQVVGLI
FT                   RQGGNRLVMKVVSVTRKPEEDGARRRAPPPPKRAPSTTLTLRSKSMTAELEELEKLDEI
FT                   LAVAAEPTLRPDIADADSRAATVKQRPTSRRITPAEISSLFERQGLPGPEKLPGSLRKG
FT                   IPRTKSVGSSAASVS"
XX
SQ   Sequence 4702 BP; 952 A; 1448 C; 1355 G; 947 T; 0 other;
     atggctgtgc gggagtgaca ctgtgggcag gagggaggca agcagcccga ggtggtagcc        60
     acctcttgct cacatgggcc tgtgtggtag tcttctcccc accttttctt tatctgagca       120
     gttccgatac aagcggagag tttatgccca gaacctcata gatgacaagc agtttgcaaa       180
     gctacacaca aaggcaaacc tgaagaagtt catggactat gtccagctac acagcacaga       240
     taaggtggcc cgcctgctgg acaaggggct ggaccccaat ttccatgacc ctgactcagg       300
     agagtgccct ctgagccttg cggcacagtt ggacaacgcc actgacctcc tgaaggttct       360
     ccgcaacggc ggtgctcatc tggacttccg gacccgagat gggctgacag ccgtccactg       420
     tgctacccgc cagcggaacg caggggcatt gacgaccctg ctggacctgg gggcttcgcc       480
     tgactacaag gacagccgcg gcctgacgcc cctgtaccat agtgccctag ggggcgggga       540
     tgccctctgt tgcgagctgc ttctccatga tcatgcacag ctggggacca ctgatgagaa       600
     tggttggcaa gagatccatc aggcctgtcg ctttggacac gtgcagcacc tggagcacct       660
     tttgttctat ggggccaaca tgggtgctca gaatgcctcg ggaaacacag ccctgcacat       720
     ctgtgccctc tacaaccagg agagctgcgc gcgcgtcctg cttttccgtg gtgccaacaa       780
     ggacgtccgc aattacaaca gccagacagc cttccaggtg gccattattg cagggaactt       840
     tgagcttgcc gaggtaatca agacccacaa agactccgat gtcgtaccat tcagggaaac       900
     ccccagctat gcaaagcgac ggcgtctggc tggcccgagt ggcctggcat ccccacggcc       960
     cttacagcgc tcagccagtg atatcaacct gaaaggtgat cagcccgcag cttctccagg      1020
     gcccactctc cgaagcctcc ctcatcaact cttgctccag aggcttcagg aggagaaaga      1080
     ccgtgacagg gatggtgaac tggagaatga catcagcggc ccctcagcag gcaggggtgg      1140
     ccacaacaag atcagcccca gtgggcccgg cggatccggc cccgcgcccg gccccggccc      1200
     ggcgtctccc gcgccccccg cgccgccgcc ccggggcccg aagcggaaac tttacagtgc      1260
     cgtccccggc cgcaagttca tcgctgtgaa ggcgcacagc ccgcagggcg agggcgagat      1320
     cccgctgcac cgcggcgagg ccgtgaaggt gctcagcatt ggggagggcg gtttctggga      1380
     gggaaccgtg aagggccgaa caggctggtt cccagctgac tgtgtggaag aagtgcagat      1440
     gcgacagtat gacacccggc atgaaaccag agaggaccgg acgaagcgtc tcttccgcca      1500
     ctacactgtg ggttcctatg acagcctcac ttcacacagc gattatgtca tcgatgataa      1560
     ggtggctatc ctgcagaaaa gggaccatga ggggtttggc tttgttctcc ggggagccaa      1620
     agcagagacc cccattgagg agtttacacc cacacctgcc ttccctgcac tccaatacct      1680
     tgagtctgta gatgtggaag gtgtggcctg gagggctgga cttcgaactg gggacttcct      1740
     cattgaggtg aacggagtga atgtcgtgaa ggttggacac aagcaagtgg tgggtctcat      1800
     ccgtcagggt ggcaaccgcc tggtcatgaa ggttgtgtct gtgaccagga aacccgagga      1860
     ggatggtgct cggcgcagag ccccaccacc cccaaagagg gctcccagca ccacgctgac      1920
     cctgcggtcc aagtccatga cggctgagct cgaggaactt gagaagttgg atgagatcct      1980
     ggcagttgcc gcggagccga cactgaggcc ggacattgca gatgctgact cgagggcggc      2040
     cactgtcaag cagcggccca ccagccggag gatcacccct gctgagatca gctcattgtt      2100
     tgagcgccag ggcctcccag gcccagagaa gctgccgggc tctctgcgga aggggattcc      2160
     acggaccaaa tctgtaggct cttcagcagc ctcggtgagc tgagcaccat ctcagcgcag      2220
     cgcagcccgg ggggcccggg cggaggggcc tcctactcgg tgcggcccag cggccggtac      2280
     cccgtggcga gacgagcccc gagcccagtg aaacccgcat cgctggagcg ggtggagggg      2340
     ctgggggcgg gcgtgggagg cgcggggcgg cccttcggcc tcacgcctcc caccatcctc      2400
     aagtcgtcca gcctctccat cccgcacgaa cccaaggaag tgcgcttcgt ggtgcgaagt      2460
     gtgagtgcgc gcagccgctc cccctcacca tctccgctgc cctcgccttc tcccggctct      2520
     ggccccagtg ccggcccgcg tcggccattt caacagaagc ccctgcagct ctggagcaag      2580
     ttcgatgtgg gcgactggct ggagagcatc cacttaggcg agcaccgaga ccgcttcgag      2640
     gaccatgaga tcgaaggcgc acacctgcct gcgctcacca aggaagactt cgtggagctg      2700
     ggcgtcacac gcgttggcca ccgcatgaac atcgagcgtg cgctcaggca gctggatggc      2760
     agctgacgcc ccactccctc tcctgttcct gctgcgccct gccggcaggg cccccacccc      2820
     tactccaggc cgcaggctcg gctcgccccc taccacggcg cccgggccag gaatgttgca      2880
     tgaatcgtcc tgtttgctgt tgcttggaga cttgccctgt acattgctta gtgccctccc      2940
     ctgccgctga accccaccca gcacacagta agggcgcgga ccgggggggc tgggtggaag      3000
     ggggtggggg cagggtgctc tggcctgacc acttcctcca tagctcctgg tggccattct      3060
     tccagagggg gaacctagtc cagcatgcga ggtcaggaca cgccttggtg actcgggggg      3120
     aggggggaga cattggggtt ctcgataggg gccaaggagc cccctgtttt acatatttta      3180
     atccactcta tatttggaaa gagaaaagga acaaatatct ctgtccgtaa tagttcccgc      3240
     cctcttcccc tctagtcctc tcgctggtcc cgccacagct gcccagtctt ccatctctgg      3300
     cccctcactg ccaccccata cagggcaggg gacactccag ctggcctggg gttagccagg      3360
     gtcctggcag cccaccctgg ggaccccggc tcagcccccc ttccctcgct gagctatagt      3420
     atgccccacc caccctttag gtgctgctca gggggacggg tggcaggcat tgcctgctgg      3480
     gcactagcag ggccaggtgg cctgggaaat tattgccctg gggctgggcc ccggtaaccc      3540
     aaaccccagc catcatcttc acagggtctc tcccacagga ggggtctaac ctttcccact      3600
     tcttgggcaa ctacagcaga gaagcctccc tgcctcgcac cccaaagact ccccaattcc      3660
     tgccctgtgt gtgtgtgtgc gccacataat gtgtgtgcac gcctgtgtgc ttgtgaaaac      3720
     tgggtgtggc tgagcgcatg ggtgccctgt gtgtgcttga ctgtgcagtg gtccccaggg      3780
     gctgttctgg atgggtggga ggtggcggca gaagcttgca cagggtgcat gcatgggtgt      3840
     gtgcccggga aggggccctg tcctgctggt gggtcctgct gttctctcag cctgtcccct      3900
     cctccccaaa cctcacccag cttaagcagg gattcttcgt gaatcctttc agcttcggga      3960
     ggcctcaagg gctccccccg caggcagtac cccttcgggc ttctaaggga attgtgggga      4020
     ccactaaaat caggccacaa cagcccttgg agagaggcaa agactcctga gggtcccctg      4080
     gcccccttac tgtgactcct cacactcagc aatgacctgt ggggtggggg gccctggggc      4140
     atttttaaac atcgggtttg gagtctggac taagctccat ccacgtcact cacaagtttc      4200
     tgtttctatt tctagctttt tttaataaaa aataaataaa taaataaata tataaataaa      4260
     tatatatata tataaaagac agaaaacagg tgttttcatg gcccaggggc ttggcacgcc      4320
     ggtctgtgcc cacctgcccc accctggccc atcggcccca ttccttagac acagagtcac      4380
     acccactaac cctctcacca acagagcagg tcacacacac agcagcagtc actgtaacag      4440
     actgccacat acacagtctc acatttacct gtgggttttt ggttctgttc aatttgggtt      4500
     tttaacttta cagggtcagt tccgcttctc cccccccccc ttttgtatgg agttccatct      4560
     ggggggcttt caaccccctg ctccagtcct gaggcctcct gaccctgacg ttgtgataca      4620
     ccccacagag atctatgttt cttatattat tattattaat aataattatt ataatattat      4680
     gtaataaatt tataagaaat ga                                               4702
//


spacer
spacer