spacer

EBI Dbfetch

ID   AJ242985; SV 1; linear; genomic DNA; STD; HUM; 294 BP.
XX
AC   AJ242985;
XX
DT   15-JUN-1999 (Rel. 60, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, exon 2
XX
KW   HLA-DRB1 gene; human leucocyte antigen DRB1;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-294
RA   Ferencik S.;
RT   ;
RL   Submitted (14-JUN-1999) to the INSDC.
RL   Ferencik S., Institute of Immunology, University Hospital of Essen,
RL   Virchowstrasse 171, 45121 Essen, GERMANY.
XX
RN   [2]
RX   DOI; 10.1034/j.1399-0039.1999.530421.x.
RX   PUBMED; 10321590.
RA   Bodmer J., Marsh S., Albert E., Bodmer W.;
RT   "Nomenclature for factors of the HLA system, 1998";
RL   Tissue Antigens 53(4 Pt 2):407-446(1999).
XX
DR   MD5; f1e0c76e414571d1665122b9af9d67e7.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..294
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>294
FT                   /codon_start=1
FT                   /gene="HLA-DRB1*"
FT                   /standard_name="MHC class II antigen"
FT                   /product="human leucocyte antigen DRB1"
FT                   /db_xref="GOA:Q9GIY3"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*14:36"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9GIY3"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="CAB45249.1"
FT                   /translation="VPTARFLEYSTSECHFFNGTERVRFLDRYFHNQEEFVRFDSDVRE
FT                   YRAVTELGRPDAEYWNSQKDLLERRRAEVDTYCRHNYGVGESFTVQRRGERGR"
FT   exon            <1..>294
FT                   /gene="HLA-DRB1*"
FT                   /number=2
XX
SQ   Sequence 294 BP; 58 A; 74 C; 108 G; 54 T; 0 other;
     gtccccacag cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg        60
     gagcgggtgc ggttcctgga cagatacttc cataaccagg aggagttcgt gcgcttcgac       120
     agcgacgtgc gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg       180
     aacagccaga aggacctcct ggagcggagg cgggccgagg tggacaccta ttgcagacac       240
     aactacgggg ttggtgagag cttcacagtg cagcggcgag gtgagcgcgg ccgg             294
//


spacer
spacer