Dbfetch

ID   AJ242909; SV 1; linear; mRNA; STD; MUS; 1359 BP.
XX
AC   AJ242909;
XX
DT   29-NOV-1999 (Rel. 61, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus mRNA for N-Acetylglucosamine kinase
XX
KW   N-Acetylglucosamine kinase.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1359
RA   Hinderlich S.;
RT   ;
RL   Submitted (28-MAY-1999) to the INSDC.
RL   Hinderlich S., Freie Universitaet Berlin, Institut fuer Molekularbiologie
RL   und Biochemie, Arnimallee 22, D-14195 Berlin-Dahlem, GERMANY.
XX
RN   [2]
RX   DOI; 10.1046/j.1432-1327.2000.01360.x.
RX   PUBMED; 10824116.
RA   Hinderlich S., Berger M., Schwarzkopf M., Effertz K., Reutter W.;
RT   "Molecular cloning and characterization of murine and human
RT   N-acetylglucosamine kinase";
RL   Eur. J. Biochem. 267(11):3301-3308(2000).
XX
DR   MD5; d24ae29e54f7b89daf6eba3c02b8015e.
DR   Ensembl-Gn; ENSMUSG00000034744; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030941; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0030910; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0030838; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030920; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031380; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030029; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0030607; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0030760; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0030713; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0030839; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030749; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031404; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029744; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0030110; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000037376; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0078375; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0078451; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0078368; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0078394; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0078860; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0078590; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0077971; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0078133; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0078021; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0078161; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0078021; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0079103; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0078015; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0077124; mus_musculus_wsbeij.
XX
CC   Related sequence:  AJ242911
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1359
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /tissue_lib="testis"
FT                   /db_xref="taxon:10090"
FT   CDS             210..1241
FT                   /product="N-Acetylglucosamine kinase"
FT                   /function="amino sugar metabolism"
FT                   /EC_number="2.7.1.59"
FT                   /db_xref="GOA:Q9QZ08"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="MGI:MGI:1860418"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9QZ08"
FT                   /protein_id="CAB61849.1"
FT                   /translation="MAALYGGVEGGGTRSKVLLLSEDGQILAEADGLSTNHWLIGTDQC
FT                   VERINEMVDRAKQKAGVDPLVPLRSLGLSLSGGEQEDAVRLLIEELRHRFPNLSENYLI
FT                   TTDAAGSIATATPDGGIVLISGTGSNCRLINPDGSESGCGGWGHMMGDEGSAYWIAHQA
FT                   VKIVFDSIDNLEAAPHDIGHVKQAMFDYFQVPDRLGILTHLYRDFDKCKFAGFCQKIAE
FT                   GAHQGDPLSRYIFRKAGEMLGRHVVAVLPEIDPVLFQGELGLPILCVGSVWKSWELLKE
FT                   GFLLALTLGREQQAQNSFSSFTLMKLRHSSALGGASLGARHIGYHLPMDYSINAIAFYS
FT                   YTF"
XX
SQ   Sequence 1359 BP; 325 A; 335 C; 410 G; 289 T; 0 other;
     cccacgcgtc cggtcacttg aacggcgggc tagaaaaaac cggaggggaa agctgcggga        60
     ggcgacacag gggcgagaga ggacgtagca tccacaccct acgcaagcgc gtcgtagtca       120
     catgacaagg ggcggtgccc gtgtgggcgg gagcgaagtc acggctaggg tcgaggttgc       180
     tacggcggac cagcggtggc aacggtagta tggccgcgct ttatggtggc gtggaagggg       240
     gaggcacacg gtccaaagtc cttttacttt ctgaggatgg gcagatcctg gcagaagcag       300
     atggactgag cacaaaccac tggctgattg gcacagacca gtgtgtggag aggatcaatg       360
     agatggtgga cagggccaaa cagaaggctg gagtggatcc tctggtgccc cttcgaagcc       420
     tgggcctgtc cctgagtggt ggggagcagg aggatgcagt gaggctcctg attgaggagt       480
     tgaggcaccg ctttcccaac ctgagtgaaa actacttaat caccacggat gcagcaggtt       540
     ccatcgccac agccacaccg gacggtggga ttgtgctcat ctctggaaca ggctccaact       600
     gtaggcttat caaccctgat ggctccgaga gtggctgtgg aggctggggc cacatgatgg       660
     gagacgaggg ctcagcctac tggattgcac accaagctgt gaaaattgtg tttgattcca       720
     tcgacaacct ggaggcagct cctcatgata ttggccatgt caagcaggcc atgttcgact       780
     atttccaggt gccagatcgg cttggaatcc tcacccattt gtatagggac tttgataaat       840
     gcaagtttgc tggattttgc cagaaaattg cagaaggtgc acatcaggga gaccctcttt       900
     ccaggtacat cttcaggaag gctggagaga tgctgggcag acatgttgtg gcagtattgc       960
     cagagattga cccggttttg ttccaagggg agcttggcct ccccattctg tgtgtgggct      1020
     cagtgtggaa gagctgggag ctcctgaagg aaggctttct cctggcgctg acgctgggcc      1080
     gagagcagca ggcacagaac tccttctcca gcttcaccct gatgaagttg cggcattctt      1140
     ctgcattggg gggtgccagc ctgggggcca ggcacattgg ataccacctt cccatggact      1200
     acagtatcaa tgccattgcc ttctattcct ataccttcta gagtctgtcc ccctgcccaa      1260
     ccagccaaca ccgagagctg ggagactttc ctttttaaaa aacacatatg gaagaaaata      1320
     aatgcacttt actccttccc taaaaaaaaa aaaaaaaag                             1359
//