spacer

EBI Dbfetch

ID   AJ238239; SV 1; linear; genomic DNA; STD; MUS; 108 BP.
XX
AC   AJ238239;
XX
DT   12-MAY-1999 (Rel. 59, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 5)
XX
DE   Mus musculus CNG3 gene, exon 5 and partial joined CDS
XX
KW   CNG3 gene; cyclic nucleotide-gated channel.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-108
RA   Gerstner A.;
RT   ;
RL   Submitted (12-APR-1999) to the INSDC.
RL   Gerstner A., Technische Universitaet Muenchen, Pharmakologie und
RL   Toxikologie, Biedersteiner Str. 29, D-80802 Muenchen, GERMANY.
XX
RN   [2]
RX   DOI; 10.1073/pnas.96.13.7553.
RX   PUBMED; 10377453.
RA   Biel M., Seeliger M., Pfeifer A., Kohler K., Gerstner A., Ludwig A.,
RA   Jaissle G., Fauser S., Zrenner E., Hofmann F.;
RT   "Selective loss of cone function in mice lacking the cyclic
RT   nucleotide-gated channel CNG3";
RL   Proc. Natl. Acad. Sci. U.S.A. 96(13):7553-7557(1999).
XX
DR   MD5; 9a1beba83e41bc4bdaec83a6a1428f80.
DR   Ensembl-Gn; ENSMUSG00000026114; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027288; mus_musculus.
DR   EuropePMC; PMC22124; 10377453.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..108
FT                   /organism="Mus musculus"
FT                   /strain="SV129"
FT                   /mol_type="genomic DNA"
FT                   /clone_lib="P1-Phage"
FT                   /db_xref="taxon:10090"
FT   mRNA            join(<1..108,AJ238240.1:1..107,AJ238241.1:1..>1428)
FT                   /gene="CNG3"
FT   CDS             join(<1..108,AJ238240.1:1..107,AJ238241.1:1..1400)
FT                   /codon_start=2
FT                   /gene="CNG3"
FT                   /product="cyclic nucleotide-gated channel"
FT                   /function="light signal transduction in cones"
FT                   /db_xref="GOA:Q9JJZ8"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="MGI:MGI:1341818"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JJZ8"
FT                   /protein_id="CAB42891.1"
FT                   /translation="RKEEPIVVDPSSNIYYRWLTAIALPVFYNWCLLVCRACFDELQSE
FT                   HLTLWLVLDYSADVLYVVDMLVRARTGFLEQGLMVRDTKRLWKHYTKTLHFKLDILSLI
FT                   PTDLAYLKLGVNYPELRFNRLLKFSRLFEFFDRTETRTNYPNVFRIGNLVLYTLIIIHW
FT                   NACIYFAISKFIGFGTDSWVYPNTSKPEYARLSRKYIYSLYWSTLTLTTIGETPPPVKD
FT                   EEYLFVVIDFLVGILIFATIVGNVGSMISNMNAPRVEFQAKIDSVKQYMQFRKVTKDLE
FT                   TRVIRWFDYLWANRKTVDEKEVLKNLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLVE
FT                   LVLKLRPTVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGSYFGEISI
FT                   LNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPDAKRALEEKGRQILMKDNL
FT                   IDEDLVAARVDTRDVEEKVEYLESSLDILQTRFARLLAEYSASQMKLKQRLTRLESQMN
FT                   RRCCGFSPDRENSEDASKTD"
FT   exon            1..108
FT                   /gene="CNG3"
FT                   /number=5
XX
SQ   Sequence 108 BP; 22 A; 33 C; 27 G; 26 T; 0 other;
     caggaaggag gagcccattg tggtggaccc ctccagcaac atctactacc gctggctgac        60
     tgccatcgcg ctcccagtct tctataactg gtgtctactt gtatgcag                    108
//


spacer
spacer