Dbfetch

ID   AJ223305; SV 1; linear; mRNA; STD; MUS; 3873 BP.
XX
AC   AJ223305;
XX
DT   31-OCT-1998 (Rel. 57, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus mRNA for G-protein coupled receptor, complete CDS
XX
KW   G-protein coupled receptor; GPR37 gene.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
OG   Plasmid pcDNA3
XX
RN   [1]
RP   1-3873
RA   Marazziti D.;
RT   ;
RL   Submitted (30-JAN-1998) to the INSDC.
RL   Marazziti D., Meccanismi di Espressione Genica, Istituto di Biologia
RL   Cellulare, CNR, "Adriano Buzzati-Traverso" Campus, Via E. Ramarini 32,
RL   I-00016 Monterotondo Scalo, ITALY.
XX
RN   [2]
RX   DOI; 10.1006/geno.1998.5433.
RX   PUBMED; 9799598.
RA   Marazziti D., Gallo A., Golini E., Matteoni R., Tocchini-Valentini G.P.;
RT   "Molecular cloning and chromosomal localization of the mouse Gpr37 gene
RT   encoding an orphan G-protein-coupled peptide receptor expressed in brain
RT   and testis";
RL   Genomics 53(3):315-324(1998).
XX
DR   MD5; f230872144ab29c02d05af354dca55ee.
DR   Ensembl-Gn; ENSMUSG00000039904; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000054867; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000200812; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3873
FT                   /organism="Mus musculus"
FT                   /plasmid="pcDNA3"
FT                   /strain="Balb/c"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /clone="M-GPR37"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:10090"
FT   CDS             1638..3440
FT                   /gene="GPR37"
FT                   /product="G-protein coupled receptor"
FT                   /db_xref="GOA:Q9QY42"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR003909"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1313297"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9QY42"
FT                   /protein_id="CAA11247.1"
FT                   /translation="MPARGAPLSRTSRLLLLLLFKVSVSAALSFVPEPRNGTCLGESCS
FT                   PLIQRRSRDARGPGNSAKDALRVHVPREKLEAEVRGATSWDLPPPRGGDTGVIEEAAAA
FT                   GPLGPPTKPPSAWRWKSAQGKEPSGHLRRRDPTDPQLFFPTSEGGEMSSKRDGIPQSRQ
FT                   EHSVKTEPRDLFYWPRRTGQLQDSQHRPSAVHEGRTLAPPGRALPQNGSADDWVPDQGG
FT                   PPRGNPTRRVRLKNPFYPLTQESYGAYAVMCLSVVIFGTGIIGNLAVMCIVCHNYYMRS
FT                   ISNSLLANLAFWDFLIIFFCLPLVIFHELTKKWLLEDFSCKIVPYIEVASLGVTTFTLC
FT                   ALCIDRFRAATNVQMYYEMIENCSSTTAKLAVIWVGALLLALPEVVLRQLSKEDLGFSG
FT                   QAPAERCVIKISPDLPDTIYVLALTYDGARLWWYFGCYFCLPTLFTITCSLVTARKIRK
FT                   AEKASTRGNKRQIHLESQMNCTVVALTILYGFCIIPENICNIVTAYMATGVSQQTMDLL
FT                   NIISQFLLFFKSCVTPVLLFCLCRPFSRAFMECCCCCCEECIQKSSTVTSDDNDNEYTT
FT                   ELELSPFSTIRREMSTFASVGTHC"
XX
SQ   Sequence 3873 BP; 853 A; 1037 C; 981 G; 1002 T; 0 other;
     ggggttgtgt gtatataaaa attggaaagg catgggcatc gtgatgggag ttcggtcctc        60
     ctcagttctc agttctgaac atatcaaggt tgctgcgttc ctcctgctcc ctgtgatcag       120
     ctctaactcc acctcctggt aggatgcttt caaagtcaat gttaaaggta acggacacct       180
     ggatccttct taccttacaa tctactctct taccgagtga aatgaaacca atgaagtctg       240
     tttcttttct gactctgctc tgctctgggg aatctaagac tgtgaatgtg tcactattcc       300
     ctggggagtc tgaagcctga gcatgcgcac cagttgctac caattgttgc agatctcaag       360
     aggcttgccc tttctacctt ctcctccagg gatccccgcc tgcaccgggg gtcctgagat       420
     ccaaccccct ccttactggt gacagattag gtcgggttgg ttggactatc tagggcaata       480
     acccatggag ttcacgtcct ccttgccttt agccgtgcag attcggcgcc tccgccctgt       540
     ttcccgggtc gctcctagct tcctattgaa agctactgcg aacgccttga aatgaaacgt       600
     gtgtgggttt agtgtgtggt aaaaccacca ggggatcccg tctctccaca aaccagatgc       660
     tctgctagaa ggaggacgag agggaggcga cctggagtga agcccgcgca gtggctgagc       720
     cgctgggaga ggccgggcca cctcccctgt ccaccatgca ccgctccgcc cgccagcagc       780
     ggttccaggc accacgctct ccacccgggt tgcgatggtg gtggcagtga caagctcctg       840
     cagcccacag cactgtgcac aaaacagcag cgcctctcct ccctctcgtt caattcaagc       900
     cttctcagcc cgtgcactag gcgcagccgc tggcgccatc cacttgtcaa ctttgaactg       960
     aaggagcagc aactttgaca gtggccgcgg gtttcgaatc tggcttctcc ttggcaacag      1020
     tccctttgaa agtcgtcgga gttaaacgaa gcaagagttt cctctgtgct ccggtggtgc      1080
     cttgtttgca agggtcccca ccccccaccc ccccgccagc cgagagtggg attgtgacag      1140
     ccagtcccct agtggagcgg acttgttttt ctttttctct agagacctct actagcgact      1200
     ggataaagca gtatggaaag gatgtaaata gcagagcaac tgttaccaag aagacagcca      1260
     ccacccaaag gctgggagga gcgcggggct tcctccaggc tgcgcccagt cgcaacatta      1320
     gggaacaatc aggtggtgtt cgcaactttt caaggtcagc ctcttggatc tgttatttcc      1380
     ctgggaacct tcgggtgcac cgagcttgga ttagatttgg ctgggaaatg ctcagaacat      1440
     gaaacgtgga aagattgtag ggatgtgttg atgacaccgt ccttccccaa gcgccctgtt      1500
     ccctcccagc aatcttctgc tcccatcctc tacccagcgg tgagtatgtg acatgtgcct      1560
     aactctctgc accaagtttg gcagcaggtg tcggtgctaa gctagagcca ggctagtagg      1620
     tgcgccctcg ccgagccatg ccagcccggg gcgcgcctct ctcgcgcaca tcgcggctgc      1680
     tgctccttct gctgtttaag gtttctgtct ctgctgccct gagctttgtc cctgagccca      1740
     ggaatggaac ttgtctgggg gagagctgtt ccccactgat ccaacgccgc agcagggatg      1800
     cccgtggacc tgggaattcg gcaaaagacg ctctgcgagt ccatgtgccc agagagaaac      1860
     tggaagcaga ggtgagaggg gcgacctctt gggacctccc accacccagg ggcggtgaca      1920
     caggtgtgat tgaagaagcg gcggctgctg ggcccttggg acctccaacc aagccaccaa      1980
     gtgcctggag atggaaaagt gcccagggta aagaaccatc cgggcatttg aggagaaggg      2040
     accccacgga tccccaactc ttctttccga catcggaggg gggagagatg agttccaagc      2100
     gcgatgggat tccccagagc aggcaggagc acagtgtgaa aacggaaccc agagatcttt      2160
     tttactggcc acgaagaact ggacaactcc aggattccca acacaggcct tcagcagtac      2220
     acgaaggaag gacccttgct cctccaggca gggcactacc gcaaaacggg tctgcagatg      2280
     actgggttcc tgaccaaggg ggtccacccc gtggaaaccc cacgcggcgc gtgagattga      2340
     agaacccctt ctacccattg acccaagaat cctacggagc ctatgcggtc atgtgcttat      2400
     ctgtggtgat ctttgggacc ggcattattg gcaacttggc agtgatgtgc atcgtgtgtc      2460
     acaattacta catgaggagc atctccaatt ctctcttggc caacctggct ttctgggact      2520
     ttctcatcat cttcttctgc ctccccctgg tcatcttcca tgagttgact aagaagtggc      2580
     ttttggaaga tttctcctgc aagatcgtgc cctatatcga ggtggcttct ctgggtgtca      2640
     ctaccttcac cttatgtgca ctgtgcatag atcgcttccg ggctgccacc aacgtccaga      2700
     tgtactatga aatgattgaa aattgctctt ccaccactgc caaacttgcc gttatctggg      2760
     ttggagctct gcttttggcc cttccggaag ttgtcctccg ccagctgagc aaggaagatt      2820
     tgggctttag tggccaggct cctgcagaac ggtgtgtcat aaagatctct cctgatttac      2880
     cggacacaat ctatgttttg gctctcacct atgatggtgc aaggctttgg tggtattttg      2940
     gctgctactt ttgtctgccc acacttttca ccatcacctg ctctctagtg actgctcgga      3000
     agatccgcaa agcggagaag gccagtaccc gtggaaacaa gcggcagatc catctagaga      3060
     gccagatgaa ctgcacagtg gtggctctga ccattttata tgggttttgc atcatccctg      3120
     aaaatatctg caacattgtc actgcctaca tggccacggg cgtctctcag cagaccatgg      3180
     acctgctcaa catcatcagc cagttccttt tgtttttcaa gtcctgtgtc acccccgtgc      3240
     tcctcttctg cctctgcaga cccttcagca gggccttcat ggagtgctgc tgctgctgct      3300
     gtgaggagtg tatccagaag tcttccactg tgaccagtga cgacaacgac aacgagtaca      3360
     ccacagagct ggagctgtcg cccttcagta ctatccgcag ggagatgtcc acttttgctt      3420
     ctgtggggac tcattgctga aggaacggct tggttagctc tgatttcttc gattttcata      3480
     ttctgtgaaa atttttactc catatttttc cttacagggg aacaatgcac acattttgaa      3540
     aagcaagtag aggaagacat attaactact ctagaactga ttttgcaaat taatatttgt      3600
     gctctgggaa aaaatgtttc tatttagtta tgtaagaaga aggaggccaa cagtctcaga      3660
     tcattttttt ctgctatggt gctaatattt tattcaaaag ttattgcacc ttaacaatat      3720
     taattgtttg atttctttct ttcttttaaa aacataatcg ttgtatattg aaggcaggcc      3780
     gggattttgc tagttatttt gtgtttgagt tgtgattgga agtacattgt atttgaaatg      3840
     gtttgttttt tccagccatg caacttagca cca                                   3873
//