spacer

EBI Dbfetch

ID   AJ222714; SV 1; linear; genomic DNA; STD; MUS; 1674 BP.
XX
AC   AJ222714;
XX
DT   03-DEC-1998 (Rel. 57, Created)
DT   15-DEC-1998 (Rel. 58, Last updated, Version 2)
XX
DE   Mus musculus CCR6 gene
XX
KW   CCR6 gene; chemokine receptor.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1674
RA   Zaballos A.;
RT   ;
RL   Submitted (03-DEC-1997) to the INSDC.
RL   Zaballos A., Inmunologia y Oncologia, Centro Nacional de Biotecnologia,
RL   Universidad Autonoma de Madrid, Campus de Cantoblanco, , 28049-Madrid,
RL   SPAIN.
XX
RN   [3]
RX   DOI; 10.1016/S0014-5793(98)01450-1.
RX   PUBMED; 9862452.
RA   Varona R., Zaballos A., Gutierrez J., Martin P., Roncal F., Albar J.P.,
RA   Ardavin C., Marquez G.;
RT   "Molecular cloning, functional characterization and mRNA expression
RT   analysis of the murine chemokine receptor CCR6 and its specific ligand
RT   MIP-3alpha";
RL   FEBS Lett. 440(1-2):188-194(1998).
XX
DR   MD5; 637887faa7c25b5b87ae1caacdf584b7.
DR   Ensembl-Gn; ENSMUSG00000040899; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000097418; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164411; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166348; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167956; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000177568; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000180103; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1674
FT                   /organism="Mus musculus"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   CDS             207..1310
FT                   /codon_start=1
FT                   /gene="CCR6"
FT                   /product="chemokine receptor"
FT                   /db_xref="GOA:O54689"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000355"
FT                   /db_xref="InterPro:IPR004067"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1333797"
FT                   /db_xref="UniProtKB/Swiss-Prot:O54689"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="CAA10956.1"
FT                   /translation="MNSTESYFGTDDYDNTEYYSIPPDHGPCSLEEVRNFTKVFVPIAY
FT                   SLICVFGLLGNIMVVMTFAFYKKARSMTDVYLLNMAITDILFVLTLPFWAVTHATNTWV
FT                   FSDALCKLMKGTYAVNFNCGMLLLACISMDRYIAIVQATKSFRVRSRTLTHSKVICVAV
FT                   WFISIIISSPTFIFNKKYELQDRDVCEPRYRSVSEPITWKLLGMGLELFFGFFTPLLFM
FT                   VFCYLFIIKTLVQAQNSKRHRAIRVVIAVVLVFLACQIPHNMVLLVTAVNTGKVGRSCS
FT                   TEKVLAYTRNVAEVLAFLHCCLNPVLYAFIGQKFRNYFMKIMKDVWCMRRKNKMPGFLC
FT                   ARVYSESYISRQTSETVENDNASSFTM"
XX
SQ   Sequence 1674 BP; 435 A; 422 C; 377 G; 440 T; 0 other;
     tctgctctcc caacatctgc actagtgaga gtgtggttga actgcccact tccctttcta        60
     caccagatct ggctctccca tccacataga gaaccacgcc tgcctggggt gagaatctac       120
     tttatcttgg cagggactct ggcatggcta ggtgtggttg cttgaaatca cactgtcacg       180
     atttctattt tcattatcat tcaggaatga attccacaga gtcctacttt ggaacggatg       240
     attatgacaa cacagagtat tattctattc ctccagacca tgggccatgc tccctagaag       300
     aggtcagaaa cttcaccaag gtatttgtgc caattgccta ctccttaata tgtgtctttg       360
     gcctcctggg caacattatg gtggtgatga cctttgcctt ctacaagaaa gccagatcca       420
     tgactgacgt ctacctgttg aacatggcca tcacagacat actctttgtc ctcaccctac       480
     cgttctgggc agttactcat gccaccaaca cttgggtttt cagcgatgca ctgtgtaaac       540
     tgatgaaagg cacatatgcg gtcaacttta actgtgggat gctgctcctg gcctgtatca       600
     gcatggaccg gtacattgcc atcgtccagg caaccaaatc tttccgggta cgctccagaa       660
     cactgacgca cagtaaggtc atctgtgtgg cagtgtggtt catctccatc atcatctcaa       720
     gccctacatt tatcttcaac aagaaatacg agctgcagga tcgtgatgtc tgtgagccac       780
     ggtacaggtc tgtctcagag cccatcacgt ggaagctgct gggtatggga ctggagctgt       840
     tctttgggtt cttcacccct ttgctgttta tggtgttctg ctatctgttc attatcaaga       900
     ccttggtgca ggcccagaac tccaagaggc acagagccat ccgagtcgtg atcgctgtgg       960
     ttctcgtgtt cctggcttgt cagatccctc acaacatggt cctcctcgtg actgcggtca      1020
     acacgggcaa agtgggccgg agctgcagca ccgagaaagt cctcgcctac accaggaacg      1080
     tggccgaggt cctggctttc ctgcattgct gcctcaaccc cgtgttgtat gcgtttattg      1140
     gacagaaatt cagaaactac ttcatgaaga tcatgaagga tgtgtggtgt atgagaagga      1200
     agaataagat gcctggcttc ctctgtgccc gggtttactc ggaaagctac atctccaggc      1260
     agaccagtga gaccgtcgaa aatgataatg catcgtcctt taccatgtaa cacgagagca      1320
     caaagcaaca ttgccccaaa agccttggtg aaacttgcta ttacatatga aaaaaaaaaa      1380
     aagccatgcc caaatatgta cagtaactat ggaaattcag caaagacttc ctgcaagttc      1440
     agaaacagcc atgaggtggc actatcagcc aaattcttcc aggttgttgg ttgacaagaa      1500
     acattgcagc tcctcccagg tttggttcta caaaataaga tgggaaatgc ccagattact      1560
     gggtttagtt gcttaatgaa cataaacata ttccagaaac gtttcatgaa ggggttcaca      1620
     gaactagttg accccctaac accccatagc cacaaaacaa ggatgttacc ttga            1674
//


spacer
spacer