Dbfetch

ID   AJ222586; SV 1; linear; mRNA; STD; MUS; 1655 BP.
XX
AC   AJ222586;
XX
DT   10-NOV-1997 (Rel. 53, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus mRNA for NEFA protein, complete cds.
XX
KW   NEFA protein.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RA   Hoefig K., Barnikol-Watanabe S., Barnikol H.U., Hilschmann N.;
RT   "cDNA sequence analysis of mouse NEFA gene";
RL   Unpublished.
XX
RN   [2]
RP   1-1655
RA   Barnikol H.U.;
RT   ;
RL   Submitted (01-NOV-1997) to the INSDC.
RL   Immunchemie, Max-Planck-Institut fuer experimentelle Medizin,
RL   Hermann-Rein-Str. 3, Goettingen D-37075, Germany.
XX
DR   MD5; e55ef4d56b27f7f6cc11e1d11d51e728.
DR   Ensembl-Gn; ENSMUSG00000030659; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032892; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0032875; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0032807; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032880; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032590; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0033386; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031918; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0032563; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0032715; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0032668; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0032809; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032700; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0033406; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031626; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032031; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000032895; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0086061; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0086143; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0086082; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0086105; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0085666; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0086602; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0086185; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0085606; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0085802; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0085646; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0085843; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0085687; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0086895; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0085595; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0084710; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1655
FT                   /organism="Mus musculus"
FT                   /strain="Swiss-Webster/NIH"
FT                   /mol_type="mRNA"
FT                   /dev_stage="15 day"
FT                   /clone_lib="lambda gt11"
FT                   /clone="pBluescript"
FT                   /tissue_type="embryo"
FT                   /db_xref="taxon:10090"
FT   sig_peptide     288..359
FT                   /gene="NEFA"
FT                   /note="ER signal peptide"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS             288..1550
FT                   /codon_start=1
FT                   /gene="NEFA"
FT                   /product="precursor NEFA protein"
FT                   /function="DNA and calcium-binding protein"
FT                   /db_xref="GOA:P81117"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR028813"
FT                   /db_xref="MGI:MGI:1858179"
FT                   /db_xref="UniProtKB/Swiss-Prot:P81117"
FT                   /protein_id="CAA10858.1"
FT                   /translation="MRWRIIQVQYCFLLVPCTLTALEAVPIDVDKTKVHNTEPVENARI
FT                   EPPDTGLYYDEYLKQVIEVLETDPHFREKLQKADIEEIRSGRLSQELDLVSHKVRTRLD
FT                   ELKRQEVGRLRMLIKAKLDALQDTGMNHHLLLKQFEHLNHQNPNTFESRDLDMLIKAAT
FT                   ADLEQYDRTRHEEFKKYEMMKEHERREYLKTLSEEKRKEEESKFEEMKRKHEDHPKVNH
FT                   PGSKDQLKEVWEETDGLDPNDFDPKTFFKLHDVNNDGFLDEQELEALFTRELEKVYNPQ
FT                   NAEDDMIEMEEERLRMREHVMSEIDNNKDRLVTLEEFLRATEKKEFLEPDSWETLDQQQ
FT                   LFTEDELKEYESIIAIQENELKKRAEELQKQKEDLQRQHDHLEAQKQEYHQAVQHLEQK
FT                   KLQQGIAPSGPAGELKFEPHT"
FT   mat_peptide     360..1547
FT                   /gene="NEFA"
FT                   /product="NEFA protein"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   misc_feature    join(1047..1049,1053..1055,1059..1061,1065..1067,
FT                   1071..1073,1080..1082)
FT                   /gene="NEFA"
FT                   /note="D,N,D,F,D,E Calcium-binding site in EF-hand-1,
FT                   putative"
FT   misc_feature    join(1203..1205,1209..1211,1215..1217,1221..1223,
FT                   1227..1229,1236..1238)
FT                   /gene="NEFA"
FT                   /note="D,N,D,L,T,E Calcium-binding site in EF-hand-2,
FT                   putative"
FT   regulatory      1637..1642
FT                   /gene="NEFA"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 1655 BP; 559 A; 333 C; 431 G; 332 T; 0 other;
     ggcacgcatt aggctgtgga tcagagcaag gcggagggcc gtgggcaggg aaaactggtg        60
     tgctcgcggc gggcatcagt cggcttagcc tcgcgcgccg ggaccctgca gagaagaaca       120
     caccagtcag tttttcaagg gaaaatcctg ggccaggagc caagtcctga tctctacaaa       180
     cttaatattg tgtagattat tttaccacct gagatctcag tggcctcatc tgtgcaagaa       240
     agagaaaatt aaataataaa aaagataaaa ccttggcctg tctgaagatg aggtggagga       300
     tcatccaagt acagtactgt tttctcttgg ttccgtgcac gctgaccgct ctggaagctg       360
     ttcctatcga tgtggacaag accaaagtac acaacactga gccagtggaa aatgcaagga       420
     tagagccacc agatactgga ctttattatg atgaatacct caagcaagtg attgaagtct       480
     tggaaacaga tccacatttc agagaaaagc tccagaaagc agacatagag gagataagga       540
     gcgggaggct gagtcaagag ctggacttag taagtcacaa agtgaggacg agactggatg       600
     agctgaagag gcaagaagta ggaagactgc ggatgctcat caaagctaag ctggatgccc       660
     ttcaagacac tggcatgaat caccaccttc ttctgaagca gtttgaacac ctgaaccacc       720
     agaatcctaa cacatttgaa tccagagatt tggatatgct aatcaaagca gctaccgcgg       780
     atctggagca atatgaccgg actcggcatg aagagtttaa gaagtacgag atgatgaagg       840
     aacacgagcg gagagagtat ttaaaaacgc tgagtgagga gaagaggaaa gaagaagagt       900
     ctaagtttga agagatgaag aggaagcacg aagaccaccc caaagttaat catcccggaa       960
     gcaaagatca actaaaagag gtttgggaag agactgatgg attggaccct aatgactttg      1020
     accccaagac atttttcaaa ttacatgatg ttaacaacga tggattcctg gatgaacaag      1080
     aattagaagc actattcaca agagagttgg agaaagtgta taacccacaa aatgcagagg      1140
     acgatatgat agaaatggaa gaggagaggc tcaggatgag agaacacgtc atgagtgaga      1200
     ttgataacaa caaagaccga ttggtgactc tggaggaatt cctgagagct acagagaaga      1260
     aagaattcct ggagcctgat agctgggaga cactggacca gcaacagtta ttcaccgagg      1320
     acgagcttaa agagtatgaa agcattattg ctatccaaga gaacgagctt aagaagaggg      1380
     cggaagagct gcagaaacag aaggaggatc tgcagcggca gcacgaccac ctcgaggcgc      1440
     agaagcagga gtatcatcag gccgtccagc acctggaaca gaagaaactt caacaaggca      1500
     ttgctccatc agggccagcg ggagagctga agtttgagcc acacacataa agtcctgatg      1560
     tctgccagaa cttggaagaa aaccgttgat tcaacatcta tttcatcttt caacatcctt      1620
     tcttttctct ccactcaata aatactttaa agcac                                 1655
//