spacer

EBI Dbfetch

ID   AJ133482; SV 2; linear; genomic DNA; STD; MUS; 1935 BP.
XX
AC   AJ133482;
XX
DT   04-JAN-2002 (Rel. 70, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 6)
XX
DE   Mus musculus ptch2 gene, exons 1-2 and joined CDS
XX
KW   patched 2 protein; ptch2 gene.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RC   revised by [3]
RA   Froehlich L.;
RT   ;
RL   Submitted (26-FEB-1999) to the INSDC.
RL   Froehlich L., Molecular Endocrinology, Max Planck Institute for
RL   Biochemistry, Am Klopferspitz 18A, Martinsried 82152, Germany.
XX
RN   [2]
RX   DOI; 10.1159/000064064.
RX   PUBMED; 12438747.
RA   Froehlich L., Zhanquin L., Beier D.R., Lanske B.;
RT   "Genomic structure and refined chromosomal localization of the mouse Ptch2
RT   gene.";
RL   Cytogenet. Genome Res. 97(1-2):106-110(2002).
XX
RN   [3]
RP   1-1935
RA   Froehlich L.;
RT   ;
RL   Submitted (02-APR-2002) to the INSDC.
RL   Froehlich L., Molecular Endocrinology, Max Planck Institute for
RL   Biochemistry, Am Klopferspitz 18A, Martinsried 82152, Germany.
XX
DR   MD5; bf8fc57c022cf706c98eef7c5dd19e00.
DR   Ensembl-Gn; ENSMUSG00000028681; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030443; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1935
FT                   /organism="Mus musculus"
FT                   /chromosome="4"
FT                   /map="between D4Mit20 and D4Mit334"
FT                   /strain="129 SvJ"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="liver"
FT                   /db_xref="taxon:10090"
FT   mRNA            join(651..1014,1434..1626,AJ133483.1:198..387,
FT                   AJ133483.1:495..564,AJ133483.1:699..790,
FT                   AJ133483.1:1400..1595,AJ133484.1:155..276,
FT                   AJ133484.1:411..558,AJ133484.1:639..770,
FT                   AJ133484.1:860..1015,AJ133484.1:1112..1204,
FT                   AJ133484.1:1549..1674,AJ133484.1:1768..1886,
FT                   AJ133484.1:1993..2341,AJ133484.1:2450..2762,
FT                   AJ133484.1:2854..2996,AJ133484.1:3082..3262,
FT                   AJ133484.1:3380..3660,AJ133484.1:3770..3907,
FT                   AJ133485.1:224..366,AJ133485.1:455..554,
FT                   AJ133485.1:852..>2418)
FT                   /gene="ptch2"
FT                   /product="patched2 protein"
FT   5'UTR           651..942
FT                   /gene="ptch2"
FT   CDS             join(943..1014,1434..1626,AJ133483.1:198..387,
FT                   AJ133483.1:495..564,AJ133483.1:699..790,
FT                   AJ133483.1:1400..1595,AJ133484.1:155..276,
FT                   AJ133484.1:411..558,AJ133484.1:639..770,
FT                   AJ133484.1:860..1015,AJ133484.1:1112..1204,
FT                   AJ133484.1:1549..1674,AJ133484.1:1768..1886,
FT                   AJ133484.1:1993..2341,AJ133484.1:2450..2762,
FT                   AJ133484.1:2854..2996,AJ133484.1:3082..3262,
FT                   AJ133484.1:3380..3660,AJ133484.1:3770..3907,
FT                   AJ133485.1:224..366,AJ133485.1:455..554,
FT                   AJ133485.1:852..1043)
FT                   /gene="ptch2"
FT                   /product="Patched 2 protein"
FT                   /db_xref="GOA:O35595"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR003392"
FT                   /db_xref="InterPro:IPR004766"
FT                   /db_xref="MGI:MGI:1095405"
FT                   /db_xref="UniProtKB/Swiss-Prot:O35595"
FT                   /protein_id="CAC88120.1"
FT                   /translation="MVRPLSLGELPPSYTPPARSSAPHILAGSLQAPLWLRAYFQGLLF
FT                   SLGCRIQKHCGKVLFLGLVAFGALALGLRVAVIETDLEQLWVEVGSRVSQELHYTKEKL
FT                   GEEAAYTSQMLIQTAHQEGGNVLTPEALDLHLQAALTASKVQVSLYGKSWDLNKICYKS
FT                   GVPLIENGMIERMIEKLFPCVILTPLDCFWEGAKLQGGSAYLPGRPDIQWTNLDPQQLL
FT                   EELGPFASLEGFRELLDKAQVGQAYVGRPCLDPDDPHCPPSAPNRHSRQAPNVAQELSG
FT                   GCHGFSHKFMHWQEELLLGGTARDLQGQLLRAEALQSTFLLMSPRQLYEHFRGDYQTHD
FT                   IGWSEEQASMVLQAWQRRFVQLAQEALPANASQQIHAFSSTTLDDILRAFSEVSTTRVV
FT                   GGYLLMLAYACVTMLRWDCAQSQGAVGLAGVLLVALAVASGLGLCALLGITFNAATTQV
FT                   LPFLALGIGVDDIFLLAHAFTKAPPDTPLPERMGECLRSTGTSVALTSVNNMVAFFMAA
FT                   LVPIPALRAFSLQAAIVVGCNFAAVMLVFPAILSLDLRRRHRQRLDVLCCFSSPCSAQV
FT                   IQMLPQELGDRAVPVGIAHLTATVQAFTHCEASSQHVVTILPPQAHLLSPASDPLGSEL
FT                   YSPGGSTRDLLSQEEGTGPQAACRPLLCAHWTLAHFARYQFAPLLLQTRAKALVLLFFG
FT                   ALLGLSLYGATLVQDGLALTDVVPRGTKEHAFLSAQLRYFSLYEVALVTQGGFDYAHSQ
FT                   RALFDLHQRFSSLKAVLPPPATQAPRTWLHYYRSWLQGIQAAFDQDWASGRITCHSYRN
FT                   GSEDGALAYKLLIQTGNAQEPLDFSQLTTRKLVDKEGLIPPELFYMGLTVWVSSDPLGL
FT                   AASQANFYPPPPEWLHDKYDTTGENLRIPAAQPLEFAQFPFLLHGLQKTADFVEAIEGA
FT                   RAACTEAGQAGVHAYPSGSPFLFWEQYLGLRRCFLLAVCILLVCTFLVCALLLLSPWTA
FT                   GLIVLVLAMMTVELFGIMGFLGIKLSAIPVVILVASIGIGVEFTVHVALGFLTSHGSRN
FT                   LRAASALEQTFAPVTDGAVSTLLGLLMLAGSNFDFIIRYFFVVLTVLTLLGLLHGLLLL
FT                   PVLLSILGPPPQVVQVYKESPQTLNSAAPQRGGLRWDRPPTLPQSFARVTTSMTVALHP
FT                   PPLPGAYVHPASEEPT"
FT   exon            943..1014
FT                   /gene="ptch2"
FT                   /number=1
FT   intron          1015..1433
FT                   /gene="ptch2"
FT                   /number=1
FT   exon            1434..1626
FT                   /gene="ptch2"
FT                   /number=2
FT   intron          1627..>1935
FT                   /gene="ptch2"
FT                   /number=2
XX
SQ   Sequence 1935 BP; 414 A; 517 C; 534 G; 470 T; 0 other;
     accgccaaaa gaaaaaaagc aattatctgc caaggcttcc aaaagtttta ggctgactga        60
     ttcaagttca ggcttaaaag ttatctgcca agacaaaggg gccccgacat gtacaaaggc       120
     aagaacatgt gaacttagga aattactgag ggcaattcgg gactggaagg caactgagtg       180
     ggtgtgaggc acttagagga aaaaaaaaag ctttagttgg atggtgcagg gctttgggct       240
     ttggtgcagc cgtgggattt gcattttaga gctgagtctg gcctgcttgg aaagagtgga       300
     aaggaggtcc ttagggttgc gctgggtcgg gaagaaaggg tggcccaaag gggaccagca       360
     gactcccttt ctcaacatcc tgacttacac ttggccaacg actagcgcct ccaggatcac       420
     cctcccttct cctctcctta gggccccgcg ggcgggctgg ggagcccggg aggcgaggca       480
     aaggggtggc cctgcctggg tggtctcctg ccccgccccc tgcggcgccg ttacctagca       540
     acggatccgg ctgcaaggca gcgggtaatt tgccgccccc ttagccaatg ggagggcgtc       600
     accccggccc gctccttttt ttctgagcct cctggtgctt cccgagatcc acagtcgcca       660
     ccttagctgt gaggtgcttc gcagccagtc gggtccaccc gcacgcggag ccctctttgg       720
     accacagccc acagatccag cggggcttgg ggccaccacc ccgcaccgcc gctgcgggct       780
     gctcctgtgc atctttacgc gcgccttacc caggaccgta tggccgttca cggcagctag       840
     gaatcctcag gtgaagccgg gcggcacaag gcgccaagct agcctatggc agcgctcaga       900
     taacgcaggt tgggggcgct cgcgcccccc atcctcacca gcatggttcg gccactgtcc       960
     cttggagagc tacctcccag ctacacacct ccagctcggt cctccgcacc tcatgtgagt      1020
     agaggggctg ggtttgtaac ttaaacgtcg cttgaacatc tgtagggcta gaagtctagt      1080
     gttactggat ctgtgtttga agacaagcga gagccagcaa gtgatttgtt agtttatttc      1140
     ctattatctg gtcagtgaaa atagttatgt ctgtgggttc acctctttgc ctagctgaca      1200
     acgagtgtgt gtgttcacga ctcataacct tctaaaaatg ggcattttca ggtgtgctta      1260
     tggagaaggc acagggaaag agagttaaat cttccacatt tgaaaccttt atctgtagct      1320
     gtttcctgcc ctgcatccag aagtcaggaa actgggactt gaccgggaga aaagggaaag      1380
     ctcctccatt gttgtgctga cagctggctg acctcctcct ctctctatcc cagatcctag      1440
     ctgggagcct gcaggctcct ctctggcttc gagcttactt ccaaggtcta ctcttctccc      1500
     tggggtgcag gatccagaaa cactgcggca aagtgctctt cctgggactg gtggcctttg      1560
     gggctctggc actgggtctc cgagtggctg taattgagac agacctagaa cagctctggg      1620
     tagaaggtga gttactggag ctggccgtag ctgctttggt caaggatcga gagggccatc      1680
     tcctgttcag agcctgtgta tctgggtgtg ttgcagaaag cctacctctc tcccaatctc      1740
     cctcagtgct gtggatgaag cccagggcat tgtgcaagct aggcaagtct ttaccatcaa      1800
     ctgtctcaca cctatctctc tcacccataa atggacaact ctagatggta gcctcttatg      1860
     aataagcttg tggaatattc atctttgatt atgtgtctgc ttatttagcg tttatagcta      1920
     ggtttctttt aactg                                                       1935
//


spacer
spacer