spacer

EBI Dbfetch

ID   AJ012488; SV 1; linear; genomic DNA; STD; MUS; 12700 BP.
XX
AC   AJ012488;
XX
DT   06-NOV-1998 (Rel. 57, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 3)
XX
DE   Mus musculus gene encoding serotonin receptor 5-HT2B, exons 1-3
XX
KW   5-HT2B; serotonin receptor.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-12700
RA   Maroteaux L.;
RT   ;
RL   Submitted (03-NOV-1998) to the INSDC.
RL   Maroteaux L., CNRS-INSERM-Strasbourg University, IGBMC, 1 rue L. Fries
RL   BP163 FRANCE , 67404 Illkirch cedex, FRANCE.
XX
RN   [2]
RA   Choi D.S., Maroteaux L.;
RT   "Genomic sequence of the 5-HT2B receptor locus";
RL   Unpublished.
XX
DR   MD5; 66884e5c83723415f1aac607eeb8f857.
DR   Ensembl-Gn; ENSMUSG00000026228; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027431; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..12700
FT                   /organism="Mus musculus"
FT                   /chromosome="1"
FT                   /map="1C4"
FT                   /strain="129/Sv"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   mRNA            join(1..1199,9105..9305,11494..12700)
FT   exon            1..1204
FT                   /number=1
FT   CDS             join(851..1199,9105..9305,11494..12383)
FT                   /product="serotonin receptor 5-HT2B"
FT                   /db_xref="GOA:Q02152"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000482"
FT                   /db_xref="InterPro:IPR002231"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:109323"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02152"
FT                   /protein_id="CAA10051.1"
FT                   /translation="MASSYKMSEQSTTSEHILQKTCDHLILTNRSGLETDSVAEEMKQT
FT                   VEGQGHTVHWAALLILAVIIPTIGGNILVILAVALEKRLQYATNYFLMSLAIADLLVGL
FT                   FVMPIALLTIMFEAIWPLPLALCPAWLFLDVLFSTASIMHLCAISLDRYIAIKKPIQAN
FT                   QCNSRATAFIKITVVWLISIGIAIPVPIKGIETDVINPHNVTCELTKDRFGSFMVFGSL
FT                   AAFFVPLTIMVVTYFLTIHTLQKKAYLVKNKPPQRLTRWTVPTVFLREDSSFSSPEKVA
FT                   MLDGSHRDKILPNSSDETLMRRMSSVGKRSAQTISNEQRASKALGVVFFLFLLMWCPFF
FT                   ITNLTLALCDSCNQTTLKTLLEIFVWIGYVSSGVNPLIYTLFNKTFREAFGRYITCNYR
FT                   ATKSVKALRKFSSTLCFGNSMVENSKFFTKHGIRNGINPAMYQSPMRLRSSTIQSSSII
FT                   LLDTLLTENDGDKAEEQVSYI"
FT   intron          1205..9103
FT                   /number=1
FT   exon            9104..9306
FT                   /number=2
FT   intron          9307..11493
FT                   /number=2
FT   exon            11494..12700
FT                   /number=3
FT   polyA_site      12680
XX
SQ   Sequence 12700 BP; 4052 A; 2502 C; 2437 G; 3709 T; 0 other;
     agtgtaatga acaaataaca taatcttcct cttaaagtgc ttctcaaggg aactgggaaa        60
     gtaaaggaga cttaagaact taaaaagaac tggttcaaag ttggcagact gatttgatta       120
     catttaaaat cttgtggaaa gaagtgatta ctactaaaag caagtatttg gctagtgata       180
     ctttgtacta ctttctctcc aacttaagaa attattttaa gaattataaa atgagttaca       240
     aacaagcttt taaatcaaca ctcattcagg ttcttagctg gtaaattctt tactcatagg       300
     tgggcttgcc tcttactggt gggccactat tctgaatgct ttctaaagtt aagggacaag       360
     gtatccaagg gccagatacc acgtaatgcg ctatcgtctc tattatcaac tctgggggca       420
     ctggctgcac tgtcacaata cataccgtcc tatcaaaacg ggagggggaa gctctagtgt       480
     ttttttactg ctttttagaa ataactacct ctgtatctag aaggaaactc tgataaattc       540
     atgtcttaaa attatagaaa aaaagaaatg ataaactaac atttttcatc cacatctatt       600
     ggtgtctttc atcaagtctt ctggaatcta agcctctaga aaatctaaaa tgtggatgtc       660
     ttacctgcaa acacggacag acgtgtacac agtcccatct tcgagagcct gaatcttttt       720
     agaaggaaga agtcaccttg gctgtgagtg tctggtgggt ttgctaaatg ctttgctaaa       780
     gcagatgact tgcttagcta ctgaccatgc tgaccactgt ctggaactgg actgagtcac       840
     caaaaggcga atggcttcat cttataaaat gtctgaacaa agcacaactt ctgagcacat       900
     tttacagaag acatgtgatc acctgatcct gactaaccgt tctggattag agacagactc       960
     agtagcagag gaaatgaagc agactgtgga gggacagggg catacagtgc actgggcagc      1020
     tctcctgata ctcgcggtga taatacccac cattggtggg aacatccttg tgattctggc      1080
     tgttgcactg gagaaaaggc tgcagtacgc taccaactac tttttaatgt ccttggcgat      1140
     agcagatttg ctggttggat tgtttgtgat gccgattgcc ctcttgacaa tcatgtttgg      1200
     tgagtatttc cccttgttcc tgccactgaa cactactaac gtagtgaaat ggacactcac      1260
     tgacctttat tttgtttgaa ataaaagaag gacctggatt aaaaacacag aagggaacat      1320
     tccttcattt ttcatgattt gtagttactg tgaaaggaca tacaaataat ttcttaggag      1380
     catgtttacc cttcctcagc catctttata aagtcattaa gttggcaata tttgtagatt      1440
     ctgcatttgt tacctaaaaa ttttagtaag taaaaaaata catttttcaa aaaattattc      1500
     atcctttccc tttaacaaag tgatcgataa ctaggacaat tgtgggactt taataataga      1560
     atcattaaat cagcgagtcc caattaaagt taggcattgt tcaaaaaatt cctctcctag      1620
     ctctttctaa cctgagtact aagctatgac atggtgtcta cacatgctag agaagatgtt      1680
     tagttacaaa aggaaatgat cttcctcaaa gtatctcaag agaggttcca tttatttaaa      1740
     gtttttatgg tatctgacca tctgtgttcc caaaaaactt gtaagttaat aaaagaaatg      1800
     gaacagaccc tgagttactg tgataataaa aatatagttt gactttcaga ttgttataat      1860
     aaaaaaagat attaaagtag gcatagagtt tctgctgtgt tacattatct ccagctatgt      1920
     gaagaacaca aatgagtctg ttgaaaggct cctgcttcaa agtcagcatt ataagaacat      1980
     ttcatcagtc aatgcttggg ataaactggt atgccactaa taaataactt aaaactatag      2040
     atgaccaggc ttctaagaac tgcacctata tcaagaataa acatacaagt tatagaaata      2100
     aagtgcacta atccagaaca tacaagctta ttaaatttaa aagtgaagga aaactgctat      2160
     tccaattatt tttataagaa acaacacaga gctatctgaa atgaagcact gtgtcttcat      2220
     atgtagcaat atggtgaggg gttaaaactt tattttaagc atcgcttgct cacccagctt      2280
     taaagcaaac taagacagga taagcaacaa cacacaagct tccactgcct tagtggactc      2340
     tttagtcagt ggcattgttt ttctcttcct tgccttcagt aattctgtaa ccttctgaat      2400
     agcctaatgg tacatgtgta ccataaagag taagaaatga gactctaaaa acagcctgaa      2460
     gctagcagga gcagagtaag gatgatgtag gttgacacag attccaactc tcaactctag      2520
     ggccctaact acagcttaaa gcataaagcc acactctgat gctttgcggg catacagaaa      2580
     atgctaaaat gctttatctt tgttttgcta acagaggatt aaaaatattg aataaagaat      2640
     agtataaatt ttacagaagt gcactttaat ttgaaagttc agtttgtaaa caccaaacat      2700
     ctgcttaatg caaaattctg agctaggtat gtaaataact ggcttaggtg aaggaatctt      2760
     agcagaggaa agttttaaag tgttcaagtt agctgacaaa caaacacttc acaaggttcc      2820
     aaatagtggg cttcccatga agtgagaaaa aaatgcttat atataaaaat tgttgcttaa      2880
     gatattaata ataaaaagca gaaaaacaaa cattctaaca taaaatatat ctatcactgc      2940
     acattaggtc ttaaattata acctatttta atagcatctc aatctgcaaa tacttaacaa      3000
     ctaataaaat aaagctttgc taccggtaat aatgctgggc aaaggagctc ttagactggg      3060
     gccaagggag caacccagaa catattcatc actgaaaatg tcacagtatg aactcatttg      3120
     agacatagtc tgtgagacag tgcatgtgga ttcatgcacc cctgggaaac attaaatgaa      3180
     tgttcataag ttggaagctg ggtacagtat atgggggacc tgatttcaaa cagtaagatc      3240
     tctgtatagc ctttcccaga agatagacaa taagattttc taaatgaaca catttgcatg      3300
     aacttctgat aatttttaaa agtagcaaca catgattttc tctaattgca tggaaaatca      3360
     tcagaacttc tgaagtgtac aaacaaaagt gttcttggtt atatatcata aaagattaat      3420
     tatcattata aacaatctta gctattacca ggaaattcaa tgaaattaac taaaaacctt      3480
     tataacagtt aagtattcaa acttaaaaac aaacaaacaa caagaataat gaactaccat      3540
     taagagcact aactgctctt ccagaggccc tgagttcaat tcccagcaac cacatggtgg      3600
     ctcacaacca tctgtaatgg gacccaatgc cctcttctgg tgagtctgaa gacaattaca      3660
     gtgtactcac atacattaaa taaacaaata aataaataaa tcttttgaaa aatttaacaa      3720
     aactaaataa agtgacaact tgaaaggaaa accaaatagg aagatgggga gggatgaagg      3780
     cagggagaca gggaacaaga taagaacatt tgagtaggaa acagaataat ttcgcttttc      3840
     cttatcaaat acattattga aaatggtaag gcaaaagtat ataacatttg gttgtgcatt      3900
     tgtttttggt ttggtttttc tgtgtagacc tggctgtctt gaatctcact ttgtagatca      3960
     ggcctgcctc tgcctcctga gtgccgggat taaagtctgc atcattgtaa ccactgggct      4020
     ccattgtaac aatttctttt taaatttata taagtccact gtagctgtct tcagaaaaac      4080
     cggaagaggg gactggatct aattacagat ggttgtgagc tgggaatctc gcagggtctc      4140
     tggaaaagca gacagtggag ccatctctac cctattgtaa caaggtttat ccatgttcca      4200
     cgagccacag cgttcccaaa aagcaggcaa aacacaatgc atgggacttg gaaagattat      4260
     ctaattctga aacaggagaa caaggcaatg agcatttttt ttttttggaa agtggaaatt      4320
     taaagaggca agaaaaaatt ttcctatgct ctaaatagct gaaaacagct aaaacactat      4380
     catagtagcc agaagatccc atatgtgcaa atgaaaacaa acacacacac acacacacac      4440
     acgcacacat gcacgcacag accctgaaac cccacaaaca aaaaataaac actaaccaac      4500
     taactcagaa gctttctaat aagtatctaa gctctgaatc attacttttt gaaatataaa      4560
     aaaatgcagt agaatttttt taaaaaagct atttagggct gtcccacaac agtcaatttc      4620
     ctaaactgtg tacctttgtg aaccctgtag gagtagtctt ttggaaagcc tttccaaaca      4680
     atctttaaag ttcttaaaat atgggatatt ttatgactca gatttataga ctgatgctaa      4740
     ttattttttc ataaactaaa agcctgccta aagggcaagt atatgtcaga tgtagtgatc      4800
     tatctcacca aagcaagggc ttttggttaa aaaaaaatca gatttctaca attagtaaaa      4860
     agaaattaag tactaacata gtcttcttcc aagcaagagc aagggcacag cgggttacaa      4920
     tacacgtagg ttagtaatgc gctagtgcag taattaacag caggaaactt caattctctg      4980
     ttctctgcct cccccggcac aggctaacgg ttaagtagct gcactgcatt cttgctgtac      5040
     ttggacagag acactggtcc tacacaggtg acctggcttg cttctgaaca tgggtcttca      5100
     ctgaagtctg gttgaccggt tactgttgaa aatagtaaca acaatgataa ctgtcatttt      5160
     ctggagtgct ttctctgtgc catactgttt cggaatactt cacacagatt attttacagt      5220
     atttcaaacc tataaatata ataccatgct aggcggtggt gatgcacgcc tttaatccca      5280
     gcacttggga ggcagaggct ggcggatttc tgagttcaag gccagcctgg tctacaaaat      5340
     gagttccagg acagccaggg ctatacagag aaaccatgtc tcgaaaaccc cccaaaaatt      5400
     aaaaatgtaa aataaaataa aaataaataa ataaaatcgt agcaagctta tgaaagagca      5460
     gcataacaga caggatctac cacaggttca ctggactgtc tgagatgata gaataattag      5520
     cagcaatatg tgaatctaga ggactgagtc tggcaattca tatgctcggc cttcatgact      5580
     gtactctgct caaacacaaa tgttaatcct accaattcca agtatcatat tcagcatata      5640
     agactaacaa gaaagtctat agaattctgg ggctgatgag gcagaaccca gtatcttttc      5700
     aattaaagat atactctata ttatatggta gaatacttag gtctcagcta gtacttgtac      5760
     aatccttgag gtgaatacgg atctattttc tgaggaaggt actagaaaca ggcaatgctt      5820
     actaagttga accttgctgg gaggcaaaca gaggcagttg agtgactccc ctcacatcat      5880
     gatctttaca gtatgcagtt tcacactgaa caaaggattg tcctactagc agttgaataa      5940
     actgtctaca aactaaaacc tgttttgctc ctgaaatatt aggccatgac atttaaccta      6000
     caattatttg ggttcccata aaaattccaa ttattccaac attactttct gtagtttttg      6060
     ttcaaagaca gtaaaggaat gaagttgaaa ctgtggtttg tgtaggttag aggacagctt      6120
     gcttagtctt ggggctctgg ctcagggagg gtgatgctag caggtaggta aggacagggt      6180
     agcaggaatt gtttttatag aagcagtcag gtagtctatg tgcctgatta actccttctt      6240
     acatgttttc tttttaagct taaatgtttg cggttccaat tgattactat aaatttaact      6300
     aatatctaat ccaagttctg ctgcaaacag gtggaacata atgcattcca acaagaaact      6360
     gtaatcctaa atcaagccca atgcctcctg tgtgctccat ggtgccacac tccagctgac      6420
     attcctagtt cctcctgtgc taagttgctg actcttgttt ggagaccagg tgttggttga      6480
     tgtgttgtca aggctggctt tcacttatta tgtggaccac aaacagctgc caccatgcct      6540
     gtggtttcct tcctgctctc aaccagcaat ttagatttta ttactattat tattttttta      6600
     agatttattt atttatttta tgtaagtaca ctgtagctgt tcttagatac ttcagaagag      6660
     ggcatcagat ttcgttacgg atggttgtga gccaccacgt ggttgctggg atttgaactc      6720
     gggaccttcg gaagagcagt cggagctctt aaccactgag ccatctcgcc agccctatat      6780
     tgttaaaaaa gatttattta tttattctat gtatataagt actctgtcgc tctctcagaa      6840
     gagagtatca gatcccatta cacgtggttg tgagccacca tgtggttgct ggaattgaac      6900
     tcatgacctc tgaaagagcc atctctccag ccctagattt tattttattt ttttaaattt      6960
     aattttatgt gtgtattttg cctacatgca tgtctatgca ctgtgggtgt gcctggtgct      7020
     tttggaggct agaaaaaggt gtcaggtccc cgtaacaatg gttacagaca cttgtgaact      7080
     gctgttatga gtgttgggaa ttaaactcaa gtcctctgga agagcagcta ggctcttaac      7140
     cactgagcca tctctccagc tcccttcctt gcttttaata aaagatttta gtaatctagt      7200
     gtcattatat tgctttcata aaagtctatc cattggtatt tcataaggta gaatcttaaa      7260
     gatccacctc ttatctcata tactcttgtt cttaaaattc tatatcactg ttagatattt      7320
     ctgattaaaa tatgattttt aataattccc acttctgctc caaaattagt gttcataaat      7380
     atattaactc tgttggaaaa tatgtctaac aaggcttcaa agacctaatt aaatcagtct      7440
     ggaaagcttt tgtttttagc ctataacaag gaatatcatg ggtcaaagag tcaaattcca      7500
     cagacatgta ctttttatat gttttctctg tggcttcctg ctcatagcta caagatttat      7560
     ggctagaatt ttccagacct taattttcaa atgcagaata cataattaag accaactaaa      7620
     caggatagtt taaattagta ggaaagtatt ttattttaaa agttctagag agactgtgtg      7680
     gatttgagga taaaacacca tagccagacg aggcagaagg gccacatact ttaggccagc      7740
     tttaggctat ggtactatct caaacaaact acccaagaaa cccgctcttc ctcctcttca      7800
     acaacaacaa caacaacaac aacaacaaca acagaatttc aagcagtatt tttagtggta      7860
     gaaaacctgc ccagcatact tcaggcccta gcttccatct ctagcaacaa acatgctctt      7920
     gagcgttttc atttttgatg cagggtcttc tatgttgccc aggttagatt tgggtctggg      7980
     gttaagtgac ccttccatgt tagcctccac agtagctggg tctctaagga ctacttcatc      8040
     ctacagtcca gactcgagca ttttcctgtt tccctgcaca gagcccagga tgtaggtttg      8100
     gcttccccgt ggtttccatg tgaagctctt ctatcagtga gtcctttcat tcttccacta      8160
     tttgcctata atgttaggtg gttagagaat gcattgtcag ttctgactaa ggtcattttc      8220
     cacggctgac agaaaactgt atactacagc taagaaactt caattattta ggttttctct      8280
     atcgaaaggt ctcttacgag ttctgtgcgt gtatgtgtgt ctgtctgtgt agaggtcaga      8340
     ggttgatgtc agaatgatgt cttcctcatt ctctttccat ctgatttttt gagaaaggat      8400
     ctctttactg agcccagagc tcagtgattt gactaggctg atcagcagat cccagggact      8460
     ctcgtttctg tctttctacc actggtgggc agggggttac tccagtgctg aaatcataag      8520
     tgcagactgt cacagcgagc tttttatatg ggtttgggga tctgacctca gcggccatgc      8580
     ttgcacggaa gcactttacc aatcaagcct cccagctcct aaatgttcct tcctatgaga      8640
     cattctgagt gtctagcaca taccagtaaa cccagggata tttttgaagt ctaagatagt      8700
     cttttctaca aagtctcccc ataggataga tgtttaaccc tatttccatg cgatcatgta      8760
     gggatgtggt tcactgcatt ttcatacaat gcctgtatat attatcagac gaaacctaag      8820
     agcctgcttg ctccatcagt gccccaggtg atatcctccc cattctctac tcttgatcag      8880
     agtacacaat gctctataga acgttttcaa ttaatatttc aattttgaca aacgccctcc      8940
     tccataaaca tactcaaaga gattagacac atttgaattg attcatttgc aatatcaaaa      9000
     acatctcaag ggtcatgtta agaggtttaa aaatatgtac tggattaaga aaaaaagatt      9060
     aaattgaaag ttgccattct ctgagcaaat gttttttctt tcagaggcta tatggcccct      9120
     cccactggcc ctgtgtcctg cctggttatt cctcgatgtt ctcttttcaa ctgcctccat      9180
     catgcatctc tgtgccattt ccctggaccg ctatatagcc atcaaaaagc caattcaggc      9240
     caatcagtgc aactcccggg ctactgcatt catcaagatt acagtggtat ggttaatttc      9300
     aataggtatg tggggaatgc ctctatttcc atatggccag aatgccagct ctggtaagta      9360
     ggaaaactca gaggtaaagg caatccactg aaacccagat acttgtatat cacattcagt      9420
     gtgcagcttc tcagccatgc catcagtaaa atctaagtca gcagtaagcc catgtcttca      9480
     gaataaacca gtgcttactg agctaccatt ccactttgat tttgatattc aggaagttta      9540
     agctccaaag tattggtatt tgtcaacaag tagttaatta aagtctaact agcttgagga      9600
     atctagccct caaagtaaat cagaaaaaaa aaattaaata catcgtaaat catgtctatc      9660
     agaataaaca aaagaggagg aaaaagccaa ccttgccaaa ttttgtatgc aggtacccaa      9720
     gaccataaac tggcccagta agtcagagtt cccatatgta cagattaaag gcagagttaa      9780
     atataaactt tagtggttta actctcaaaa agatgttaag ccaatgttta gagatgattt      9840
     ttagacagaa atcaatttcc tttaacccat tatttttctg agctcattgt tttttaagga      9900
     ttagaattta ttctgtatat ggtgctttgc ctgcacatat gtatgtgcat cttgtgtgtg      9960
     cctcatgtcc aaggagagca gatgagggca ttggagtttc agcatgttgt gagatacttt     10020
     tccagtctgc tgtcatcatt gacactccaa agatatctgc tgctagggta cctcaagaga     10080
     gtgtggcact cattcgaagc tctcctgagt tagtaccaga gaaaggttcg cagatttgta     10140
     acacataatc tgaccaggga tttactgctt cccagtagaa agaacatttt tccccccgag     10200
     acaggtttct ctgtgtagcc ctggctgtcc tggaacttac tctgtagacc aggataacca     10260
     tgaactcagg gattcgcctg cctctgcctc ccaagtgctg ggagtaaagg tgtgcgcaac     10320
     cactgcccag ctgaaagaac attttttgaa aaggaaaata atgacgagac ctgaagtgct     10380
     aaaagaggag aaaacagcca ttgcttgttt ctctctaatc agtgtcagaa cgtgttcaat     10440
     aaggcaagat agatactgaa attatcccca cattgcttaa acattggctc tagagcctag     10500
     acatttttga gaagcctggg aggaagaagg gtcaaggaaa tatctttaga gaacacagag     10560
     actgttatgt caagcagtag atgatcagaa cggagaagaa cagcagaaat aacgaggtag     10620
     gtcagggatc agcagtcttt ctataaaggg caggaatatg gtgacagttt gtcagaactt     10680
     atctaaacgg aggctggata acctgacttc ataaacatca aatttttgct aagtatctat     10740
     aatgtgcaag cttctaggaa tatatatatg gacaaaagcc aggtggtggc ggcacacatc     10800
     tttaatcagg gcacttgtga ggcagaggga agcaaatctc tgagtctgag gccagcctgg     10860
     tctacagatg tagttccaag taccagggct aacacagaaa aaccctgtct tgaaaaagcc     10920
     aaaagcacaa aaagaaaaaa aagttacatg ggggaaaaaa aaaagacaaa gctctgacag     10980
     acggcttagc agctatgtgc tatgtaagta ccttagacgg ctcagactta aggtgctgta     11040
     agagagtaaa agaaaggcct gtaaccacca cacctggctc aggcagcaac tttctaagga     11100
     agaagatttt gttttctcta aaaagttagg attacatgat actcatagca ctgaaagata     11160
     aaattcttag gtgtgcctgt acaacctcaa agataataag atagatactg cctgaaaact     11220
     aggacaccaa atctccaaat tctctctaaa ttaattaccc tggatattaa ccttatcttc     11280
     tgaattcttt tccaatatga agactagcag atgctcagtt agattccatt agtcaaagga     11340
     tctgttgata aatcctgaac agatttgaag gaactgaagg tctcaggaat tataaagcac     11400
     tcattagcaa gatgttacta agataaacct caaaataact gatctaagaa cagatcatga     11460
     atgacttaat ttatctaact tggtcttcct taggcatcgc catcccagtc cctattaaag     11520
     gaatcgagac tgatgtgatt aatccacaca atgtcacctg tgagctgaca aaggaccgct     11580
     ttggcagttt tatggtcttt gggtcactgg ctgctttctt cgtacctctc accatcatgg     11640
     tagtcactta ctttctcacc attcacactt tacagaagaa agcttacttg gtcaaaaata     11700
     agccacctca acgcctaaca cggtggactg tgcccacagt tttcctaagg gaagactcat     11760
     ccttttcatc accagaaaag gtggcaatgc tggatgggtc tcacagggat aaaattctac     11820
     ctaactcaag tgatgagaca cttatgcgaa gaatgtcctc agttggaaaa agatcagccc     11880
     aaaccatttc taatgagcag agagcctcga aggcccttgg agtcgtgttt ttcctttttc     11940
     tgcttatgtg gtgccccttt tttattacaa atctaacttt agctctgtgt gattcctgca     12000
     atcagaccac tctcaaaaca ctcctggaga tatttgtgtg gataggctac gtttcctcgg     12060
     gggtgaatcc tctgatctat acactcttca ataagacatt tcgggaagca tttggcaggt     12120
     acatcacctg caattaccga gccacaaagt cagtaaaagc acttaggaag ttttccagta     12180
     cactttgttt tgggaattca atggtagaaa actctaaatt tttcacaaaa catggaattc     12240
     gaaatgggat caaccctgcc atgtaccaga gcccaatgag gctccgaagt tcaaccattc     12300
     agtcctcatc aatcatcctc ctcgataccc ttctcactga aaacgatgga gacaaagcgg     12360
     aagagcaggt cagctacata tagcagaacg ggccgccctc atctgagaga ggtgatgagc     12420
     aggacgcacg cgcaccatgg aaaggtacag agtgaatgaa aaccccaccc tctcctgagt     12480
     gaagtaccaa ggctgtccag cttccttatc taaacaaact caagcatggc taaagtagat     12540
     ctgatggctt caaacaaacg caatctctac tctggttttc aaatacaatt aaataagttg     12600
     ataaatttca gtcttttaaa aaaaaagaat gtcaacaaat ttttaagttt ctaatgtgtg     12660
     taaagttgtg ttaagaaaga aataaaatga aacaaaaaaa                           12700
//


spacer
spacer