Dbfetch

ID   AJ012475; SV 1; linear; mRNA; STD; MUS; 2661 BP.
XX
AC   AJ012475;
XX
DT   16-MAR-1999 (Rel. 59, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus mRNA for Capn7 protein
XX
KW   capn7 gene.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2661
RA   Dear T.N.;
RT   ;
RL   Submitted (02-NOV-1998) to the INSDC.
RL   Dear T.N., Not applicable, Max-Planck Institute for Immmunobiology,
RL   Stuebeweg 51, 79108 Freiburg, GERMANY.
XX
RN   [2]
RX   DOI; 10.1007/s003359900995.
RX   PUBMED; 10051333.
RA   Franz T., Vingron M., Boehm T., Dear T.;
RT   "Capn7: a highly divergent vertebrate calpain with a novel C-terminal
RT   domain";
RL   Mamm. Genome 10(3):318-321(1999).
XX
DR   MD5; fcc704a4828b4d8bc4df5734f715024f.
DR   Ensembl-Gn; ENSMUSG00000021893; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0021127; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0021075; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0021052; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0021079; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020862; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021511; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020387; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0020829; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0020951; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0020935; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0021020; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020961; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021544; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0020135; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020442; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000022451; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0038798; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0038758; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0038719; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0038761; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0038505; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0039216; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0038512; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0038425; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0038566; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0038536; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0038655; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0038524; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0039261; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0038126; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0037908; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2661
FT                   /organism="Mus musculus"
FT                   /chromosome="3"
FT                   /map="3p24-p25"
FT                   /mol_type="mRNA"
FT                   /dev_stage="embryo day 17"
FT                   /db_xref="taxon:10090"
FT   CDS             104..2413
FT                   /gene="capn7"
FT                   /product="Capn7"
FT                   /db_xref="GOA:Q9R1S8"
FT                   /db_xref="InterPro:IPR001300"
FT                   /db_xref="InterPro:IPR007330"
FT                   /db_xref="InterPro:IPR022682"
FT                   /db_xref="InterPro:IPR022683"
FT                   /db_xref="InterPro:IPR022684"
FT                   /db_xref="MGI:MGI:1338030"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9R1S8"
FT                   /protein_id="CAB39203.1"
FT                   /translation="MAGSSLERIQEKINEYLERVQALHSAVQSKSTDPLKSKHQLDLER
FT                   AHFLVTQAFDEDEKGNVEDAIELYTEAVELCLKTSSETADKTLQNKLKQLARQALDRAE
FT                   ALSEPLTKPFCKLKSANMKTKTPPVRTHFPLGPNPFVEKPQAFISPQSCDAQGQKYTAE
FT                   EIEVLRTTSKINGVEYVPFMSVDLRERFAYPMPFCDRLGKLPLSPKQKTTFSKWVRPED
FT                   LTNNPTMIYTVSSFSIKQTIVSDCSFVASLAISAAYERRFNKKLITSIIYPQNKDGEPE
FT                   YNPCGKYMVKLHLNGVPRKVIIDDQLPVDHKGELLCSYSNNKSELWVSLIEKAYMKVMG
FT                   GYDFPGSNSNIDLHALTGWIPERIAMHSDSQTFSKDNSFRMLYQRFHKGDVLITASTGV
FT                   MTEAEGEKWGLVPTHAYAVLDIREFKGLRFIQLKNPWSHLRWKGRYSENDVKNWTPELQ
FT                   KYLNFDPRTAQKIDNGIFWISWDDLCQYYDVVYLSWNPALFKESTCIHSTWDAKQGPVK
FT                   DAYSLANNPQYKLEVQCPQGGAAVWVLLSRHITDKDDFANNREFITMVVYKTDGKKVYY
FT                   PADPPPYIDGIRINSPHYLTKIKLTTPGTHTFTLVVSQYEKQNTIHYTVRVYSACSFTF
FT                   SKIPSPYTLSKRINGKWSGQSAGGCGNFQETHKNNPIYQFHIDKTGPLLIELRGPRQYS
FT                   VGFEVVAVSIMGDPGPHGFQRKSSGDYRCGFCYLELENIPAGIFNIIPSTFLPKQEGPF
FT                   FLDFNSTVPIKTTQLQ"
XX
SQ   Sequence 2661 BP; 830 A; 526 C; 597 G; 708 T; 0 other;
     cgtgcagttc gcgcggctgg cagtgcagcg cgaccacgaa ggccgctact ctgaggcggt        60
     gttttactac aaggaagctg cccaagcttt aatttatgct gagatggcag gatccagcct       120
     agaaaggatc caagagaaga tcaatgagta tctggaaaga gtgcaagccc ttcactctgc       180
     agttcagtca aagagtactg atcctttgaa atcaaaacac cagttggatc tagaacgtgc       240
     ccattttctt gttacacaag ctttcgatga agatgaaaag gggaatgtgg aagatgccat       300
     agaattatat acagaagctg tggaactctg tctaaaaacc tcttctgaaa ctgctgacaa       360
     gactctgcaa aataaattga aacagttggc tcgacaggca ctagatagag cagaagcatt       420
     gagtgaacct ttgacaaagc cattttgcaa actcaagtca gcaaatatga aaacaaagac       480
     tcctccagta agaacacact ttcctctagg acctaatcct ttcgttgaaa agcctcaagc       540
     atttataagt ccacagtcat gtgatgcgca aggacagaag tacacagcag aagagataga       600
     agtgctcagg acaacatcaa aaataaatgg tgtagaatat gttcctttca tgagtgttga       660
     tctaagggaa cgctttgctt atccaatgcc tttttgtgat aggttgggca agcttccatt       720
     atcacctaaa caaaaaacta cattttctaa atgggtacga ccggaagatc tcaccaacaa       780
     tcctacaatg atatacactg tgtccagttt tagcataaag cagacaatag tatcagattg       840
     ttcctttgtg gcatcgttgg ctatcagtgc agcgtatgag agacgattca ataagaagtt       900
     aattaccagc ataatttacc cccagaataa ggatggagaa ccagagtaca atccctgtgg       960
     aaagtatatg gtaaagcttc acctcaatgg tgttccgaga aaggtgataa ttgatgacca      1020
     gttacctgtt gatcacaaag gagaattgct gtgttcttat tccaacaata aaagtgaatt      1080
     gtgggtgtca cttatagaga aagcatacat gaaagttatg ggaggatatg atttcccagg      1140
     atccaactca aatattgatc tgcatgcact gactgggtgg ataccagaaa ggattgccat      1200
     gcattcagat agccagacgt tcagtaagga taactcattc agaatgcttt atcaaagatt      1260
     tcacaaagga gatgtcctca tcaccgcatc gacgggagta atgactgaag ctgaagggga      1320
     gaagtggggc ctggttccca ctcatgccta tgcggttttg gatattagag agttcaaggg      1380
     gctgagattt attcagttaa aaaacccttg gagccattta cgctggaaag gaaggtacag      1440
     tgagaatgat gtgaaaaact ggaccccaga attgcagaag tatttaaact ttgatccacg      1500
     aacagctcag aaaatagata atggaatatt ttggatttcc tgggatgatc tttgccagta      1560
     ttatgatgta gtttatttga gttggaatcc agctcttttt aaagaatcaa cttgcattca      1620
     cagtacttgg gatgctaaac aaggacctgt gaaagatgct tatagcctgg ccaacaaccc      1680
     ccagtacaaa ttggaggtgc agtgtccaca agggggtgct gcagtttggg ttttgcttag      1740
     tagacacata acagacaagg atgacttcgc aaataaccgt gagtttatca caatggttgt      1800
     gtacaagact gatggcaaga aggtttacta cccagctgac ccacctccat acattgatgg      1860
     gattcgaatt aacagccctc attacttgac taagataaag ctgaccacgc ccgggactca      1920
     caccttcacc ctagtggttt ctcagtatga gaaacagaat acgattcatt acacagtccg      1980
     ggtgtattca gcctgcagct ttactttttc gaagatccct tcaccataca ccttatccaa      2040
     acggataaat ggaaagtgga gtggtcaaag tgctggagga tgtggaaatt ttcaggagac      2100
     tcacaaaaat aaccccatct accaattcca tatagataag actggaccgt tattgattga      2160
     gctgagagga ccaaggcaat acagtgttgg atttgaggtt gtagcagttt ccataatggg      2220
     agatcctggt cctcatggct ttcagaggaa atctagtggt gactataggt gtggattttg      2280
     ctacttagaa ctggaaaaca tacctgctgg gatctttaat atcatcccta gtactttttt      2340
     gcctaaacaa gaaggacctt ttttcttgga ctttaatagt actgtcccca tcaagacaac      2400
     acaactccaa tgattgagaa ctctcagcta ttactggatt ccatatttcc cagtctcagc      2460
     tcttcagaca aggagacaaa tcacgatggt gaaccatcag aatggaatta aatcaaaagc      2520
     atgttacgga gtctggtgct cgttgtggtg tttggtaagg attttagata gtggaattac      2580
     cttaatcacc tgaaatactg tttacatggt ttgtgcacac agagctggcg tgtactcggt      2640
     ggcggctctg tgtaaatcac a                                                2661
//