Dbfetch

ID   AJ011912; SV 1; linear; mRNA; STD; MUS; 1755 BP.
XX
AC   AJ011912;
XX
DT   17-OCT-1998 (Rel. 57, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus mRNA for putative tripeptidyl peptidase I
XX
KW   lysosomal; pepstatin-insensitive carboxyl protease;
KW   tripeptidyl peptidase I.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1755
RA   Vines D.J.;
RT   ;
RL   Submitted (15-OCT-1998) to the INSDC.
RL   Vines D.J., Department of Histopathology, St George's Hospital Medical
RL   School, Cranmer Terrace, Tooting, London SW17 0RE, UK.
XX
RN   [2]
RX   DOI; 10.1016/S0014-5793(98)01683-4.
RX   PUBMED; 9989590.
RA   Vines D.J., Warburton M.J.;
RT   "Classical late infantile neuronal ceroid lipofuscinosis fibroblasts are
RT   deficient in lysosomal tripeptidyl peptidase I";
RL   FEBS Lett. 443(2):131-135(1999).
XX
DR   MD5; ec2518fd0f1f4fc034b039bf4f5f0d0f.
DR   Ensembl-Gn; ENSMUSG00000030894; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032764; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0032744; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0032677; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032750; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032459; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0033255; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031789; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0032433; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0032586; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0032539; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0032677; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032571; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0033276; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031502; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031906; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000033184; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0085705; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0085775; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0085721; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0085744; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0085302; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0086245; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0085822; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0085246; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0085441; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0085293; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0085484; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0085335; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0086531; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0085235; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0084359; mus_musculus_wsbeij.
DR   EuropePMC; PMC1377895; 10330339.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1755
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             102..1718
FT                   /standard_name="lysosomal pepstatin-insensitive carboxyl
FT                   protease"
FT                   /product="putative tripeptidyl peptidase I"
FT                   /db_xref="GOA:O89023"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR009020"
FT                   /db_xref="InterPro:IPR015366"
FT                   /db_xref="InterPro:IPR030400"
FT                   /db_xref="MGI:MGI:1336194"
FT                   /db_xref="UniProtKB/Swiss-Prot:O89023"
FT                   /protein_id="CAA09863.1"
FT                   /translation="MLPPGWVSLGRVDPEEELSLTFALKQRNLERLSELVQAVSDPSSP
FT                   QYGKYLTLEDVAELVQPSPLTLLTVQKWLSAAGARNCDSVTTQDFLTCWLSVRQAELLL
FT                   PGAEFHRYVGGPTKTHVIRSPHPYQLPQALAPHVDFVGGLHRFPPSSPRQRPEPQQVGT
FT                   VSLHLGVTPSVLRQRYNLTAKDVGSGTTNNSQACAQFLEQYFHNSDLTEFMRLFGGSFT
FT                   HQASVAKVVGKQGRGRAGIEASLDVEYLMSAGANISTWVYSSPGRHEAQEPFLQWLLLL
FT                   SNESSLPHVHTVSYGDDEDSLSSIYIQRVNTEFMKAAARGLTLLFASGDTGAGCWSVSG
FT                   RHKFRPSFPASSPYVTTVGGTSFKNPFLITDEVVDYISGGGFSNVFPRPPYQEEAVAQF
FT                   LKSSSHLPPSSYFNASGRAYPDVAALSDGYWVVSNMVPIPWVSGTSASTPVFGGILSLI
FT                   NEHRILNGRPPLGFLNPRLYQQHGTGLFDVTHGCHESCLNEEVEGQGFCSGPGWDPVTG
FT                   WGTPNFPALLKTLLNLDPFVP"
XX
SQ   Sequence 1755 BP; 382 A; 510 C; 447 G; 416 T; 0 other;
     gaattcggat ccatgtggga ctccaagccc gcctcctagg gctccttgct ctcgtcatcg        60
     ccggcaaatg cacttacaac cctgagccgg accagcggtg gatgctgcct ccaggctggg       120
     tgtccctggg ccgcgtggat cccgaggaag agctgagtct cacttttgcg ctgaaacagc       180
     ggaacctgga aagactctcg gagctggtgc aggctgtgtc ggatcctagc tctcctcaat       240
     atggaaagta cctaaccctg gaggatgtag ctgagctggt tcaaccatca cccctgaccc       300
     tcctcactgt ccaaaagtgg ctctcagcag ctggagcccg gaactgcgat tcagtgacca       360
     cccaggactt tctgacttgc tggctgagtg tccgacaggc tgagctgctg ctcccaggag       420
     ctgagtttca tcgctatgta gggggaccta caaagaccca tgttataagg tccccacatc       480
     cctaccagct tccccaggcc ttggcccctc atgtggattt tgtggggggg ctgcaccgtt       540
     tccccccttc atctccaaga caacgtccag aaccacaaca ggtaggaact gttagcctgc       600
     acttgggagt gactccgtct gtgctccgtc agcgatacaa cctgacagcc aaagatgtgg       660
     gctcaggcac caccaacaat agccaggcct gtgcccagtt cctggaacag tacttccata       720
     actcggatct gactgagttc atgcgcctat tcggtggcag ttttacacac caggcctcag       780
     tagcaaaagt tgttggaaag caagggcgag gccgagctgg gatcgaggcc agtctagatg       840
     tggaatacct gatgagtgct ggtgccaata tctccacttg ggtctacagt agccctggcc       900
     gccatgaggc acaggagccc ttcttacaat ggctcctgct tcttagcaat gagtcatctt       960
     tgccacatgt acatactgtg agttacggag acgatgaaga ctccctcagc agcatctaca      1020
     tccagagagt caacactgag ttcatgaagg ctgctgctcg gggtctcacc ctcctttttg      1080
     cctcaggtga cactggagct gggtgttggt ctgtctccgg aagacacaag ttccgcccta      1140
     gcttccctgc ttccagcccc tatgttacta cagttggagg aacctccttc aagaatcctt      1200
     tcctcatcac agatgaagta gttgactata tcagtggtgg aggcttcagc aatgttttcc      1260
     cacggcctcc ctaccaggag gaagcagtgg cccagttctt gaaatccagc tctcatctac      1320
     caccatccag ttacttcaat gctagtggcc gtgcctaccc agatgttgcc gcactatctg      1380
     atggctactg ggtggtcagc aacatggtcc ccattccatg ggtatctgga acctcggcct      1440
     ctactccagt gtttggggga attttatcct tgataaatga gcacagaatc ctcaatggcc      1500
     gccctcctct tggctttctc aaccccaggc tctatcagca gcatgggaca ggactctttg      1560
     atgtaaccca cggctgccat gagtcctgtc tgaatgaaga agtggagggt cagggtttct      1620
     gctctggtcc tggctgggat cctgtgacag gttggggaac acccaacttc ccagccctac      1680
     tgaagaccct gctcaacctt gaccctttcg tgccatgacg agaaagcaga actgttccct      1740
     gtactaaaag ggaag                                                       1755
//