Dbfetch

ID   AJ011413; SV 1; linear; mRNA; STD; MUS; 2050 BP.
XX
AC   AJ011413;
XX
DT   22-SEP-1998 (Rel. 57, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus mRNA for serum albumin
XX
KW   serum albumin.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2050
RA   Van Reeth T.;
RT   ;
RL   Submitted (18-SEP-1998) to the INSDC.
RL   Van Reeth T., Departement de Biologie Moleculaire, Universite Libre de
RL   Bruxelles, Laboratoire de Biologie du Developpement, rue des chevaux, 67,
RL   1640 Rhode St Genese, BELGIUM.
XX
RN   [2]
RA   Van Reeth T., Gabant P., Dreze P., Szpirer J., Szpirer C.;
RT   ;
RL   Unpublished.
XX
RN   [3]
RA   Cable J., Harris P.D., Tinsley R.C., Lazarus C.M.;
RT   "Phylogenetic analysis of Gyrodactylus spp. (Platyhelmithes: Monogenea)
RT   using rDNA sequences.";
RL   Can. J. Zool. 77:1439-1449(1999).
XX
DR   MD5; 600b23cdc359ab292c08a4ffddf7a939.
DR   Ensembl-Gn; ENSMUSG00000029368; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029721; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0029687; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0029633; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029697; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029420; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030151; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028830; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0029390; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0029534; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0029493; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0029622; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029522; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030185; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028549; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028909; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000031314; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0072543; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0072622; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0072536; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0072549; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0072192; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0073016; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072736; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0072149; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0072280; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0072183; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0072336; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0072185; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0073230; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0072204; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0071339; mus_musculus_wsbeij.
DR   EuropePMC; PMC298769; 12552098.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2050
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /tissue_type="liver"
FT                   /db_xref="taxon:10090"
FT   CDS             34..1860
FT                   /product="serum albumin"
FT                   /db_xref="GOA:P07724"
FT                   /db_xref="InterPro:IPR000264"
FT                   /db_xref="InterPro:IPR014760"
FT                   /db_xref="InterPro:IPR020857"
FT                   /db_xref="InterPro:IPR020858"
FT                   /db_xref="InterPro:IPR021177"
FT                   /db_xref="MGI:MGI:87991"
FT                   /db_xref="UniProtKB/Swiss-Prot:P07724"
FT                   /protein_id="CAA09617.1"
FT                   /translation="MKWVTFLLLLFVSGSAFSRGVFRREAHKSEIAHRYNDLGEQHFKG
FT                   LVLIAFSQYLQKCSYDEHAKLVQEVTDFAKTCVADESAANCDKSLHTLFGDKLCAIPNL
FT                   RENYGELADCCTKQEPERNECFLQHKDDNPSLPPFERPEAEAMCTSFKENPTTFMGHYL
FT                   HEVARRHPYFYAPELLYYAEQYNEILTQCCAEADKESCLTPKLDGVKEKALVSSVRQRM
FT                   KCSSMQKFGERAFKAWAVARLSQTFPNADFAEITKLATDLTKVNKECCHGDLLECADDR
FT                   AELAKYMCENQATISSKLQTCCDKPLLKKAHCLSEVEHDTMPADLPAIAADFVEDQEVC
FT                   KNYAEAKDVFLGTFLYEYSRRHPDYSVSLLLRLAKKYEATLEKCCAEANPPACYGTVLA
FT                   EFQPLVEEPKNLVKTNCDLYEKLGEYGFQNAILVRYTQKAPQVSTPTLVEAARNLGRVG
FT                   TKCCTLPEDQRLPCVEDYLSAILNRVCLLHEKTPVSEHVTKCCSGSLVERRPCFSALTV
FT                   DETYVPKEFKAETFTFHSDICTLPEKEKQIKKQTALAELVKHKPKATAEQLKTVMDDFA
FT                   QFLDTCCKAADKDTCFSTEGPNLVTRCKDALA"
XX
SQ   Sequence 2050 BP; 596 A; 494 C; 468 G; 492 T; 0 other;
     ctttcctatc aaccccactt agcctctggc aaaatgaagt gggtaacctt tctcctcctc        60
     ctcttcgtct ccggttctgc tttttccagg ggtgtgtttc gccgagaagc acacaagagt       120
     gagatcgccc atcggtataa tgatttggga gaacaacatt tcaaaggcct agtcctgatt       180
     gccttttccc agtatctcca gaaatgctca tacgatgagc atgccaaatt agtgcaggaa       240
     gtaacagact ttgcaaagac gtgtgttgcc gatgagtctg ccgccaactg tgacaaatcc       300
     cttcacactc tttttggaga taagttgtgt gccattccaa acctccgtga aaactatggt       360
     gaactggctg actgctgtac aaaacaagag cccgaaagaa acgaatgttt cctgcaacac       420
     aaagatgaca accccagcct gccaccattt gaaaggccag aggctgaggc catgtgcacc       480
     tcctttaagg aaaacccaac cacctttatg ggacactatt tgcatgaagt tgccagaaga       540
     catccttatt tctatgcccc agaacttctt tactatgctg agcagtacaa tgagattctg       600
     acccagtgtt gtgcagaggc tgacaaggaa agctgcctga ccccgaagct tgatggtgtg       660
     aaggagaaag cattggtctc atctgtccgt cagagaatga agtgctccag tatgcagaag       720
     tttggagaga gagcttttaa agcatgggca gtagctcgtc tgagccagac attccccaat       780
     gctgactttg cagaaatcac caaattggca acagacctga ccaaagtcaa caaggagtgc       840
     tgccatggtg acctgctgga atgcgcagat gacagggcgg aacttgccaa gtacatgtgt       900
     gaaaaccagg cgactatctc cagcaaactg cagacttgct gcgataaacc actgttgaag       960
     aaagcccact gtcttagtga ggtggagcat gacaccatgc ctgctgatct gcctgccatt      1020
     gctgctgatt ttgttgagga ccaggaagtg tgcaagaact atgctgaggc caaggatgtc      1080
     ttcctgggca cgttcttgta tgaatattca agaagacacc ctgattactc tgtatccctg      1140
     ttgctgagac ttgctaagaa atatgaagcc actctggaaa agtgctgcgc tgaagccaat      1200
     cctcccgcat gctacggcac agtgcttgct gaatttcagc ctcttgtaga agagcctaag      1260
     aacttggtca aaaccaactg tgatctttac gagaagcttg gagaatatgg attccaaaat      1320
     gccattctag ttcgctacac ccagaaagca cctcaggtgt caaccccaac tctcgtggag      1380
     gctgcaagaa acctaggaag agtgggcacc aagtgttgta cacttcctga agatcagaga      1440
     ctgccttgtg tggaagacta tctgtctgca atcctgaacc gtgtgtgtct gctgcatgag      1500
     aagaccccag tgagtgagca tgttaccaag tgctgtagtg gatccctggt ggaaaggcgg      1560
     ccatgcttct ctgctctgac agttgatgaa acatatgtcc ccaaagagtt taaagctgag      1620
     accttcacct tccactctga tatctgcaca cttccagaga aggagaagca gattaagaaa      1680
     caaacggctc ttgctgagct ggtgaagcac aagcccaagg ctacagcgga gcaactgaag      1740
     actgtcatgg atgactttgc acagttcctg gatacatgtt gcaaggctgc tgacaaggac      1800
     acctgcttct cgactgaggg tccaaacctt gtcactagat gcaaagacgc cttagcctaa      1860
     acacatcaca accacaacct tctcaggcta ccctgagaaa aaaagacatg aagactcagg      1920
     actcatcttt tctgttggtg taaaatcaac accctaggaa cacaaatttc tttaaacatt      1980
     tgacttcttg tctctgtgct gcaattaata aaaaatggaa agaatctaaa aaaaaaaaaa      2040
     aaaaaaaaaa                                                             2050
//