Dbfetch

ID   AJ011369; SV 1; linear; mRNA; STD; MUS; 1268 BP.
XX
AC   AJ011369;
XX
DT   21-SEP-1998 (Rel. 57, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus mRNA for serotonin 4 receptor, splice variant m5-HT4(f)
XX
KW   5-HT4 gene; serotonin 4 receptor; splice variant.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1268
RA   Dumuis A.;
RT   ;
RL   Submitted (16-SEP-1998) to the INSDC.
RL   Dumuis A., CCIPE, CNRS UPR 9023, 141 rue de la Cardonille, 34094
RL   Montpellier cedex 5, FRANCE.
XX
RN   [2]
RX   PUBMED; 10220570.
RA   Claeysen S., Sebben M., Becamel C., Bockaert J., Dumuis A.;
RT   "Novel brain-specific 5-HT4 receptor splice variants show marked
RT   constitutive activity: role of the C-terminal intracellular domain";
RL   Mol. Pharmacol. 55(5):910-920(1999).
XX
DR   MD5; e652d965dbbc501460018db0ae732f4a.
DR   Ensembl-Gn; ENSMUSG00000026322; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024490; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0024457; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0024427; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024456; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024224; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024903; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023697; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0024194; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0024324; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0024290; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0024408; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024319; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024950; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023440; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023761; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000027560; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049847; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0049829; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0049792; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049785; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049519; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050274; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049643; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0049452; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0049546; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0049523; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0049675; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049518; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050392; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049241; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048814; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1268
FT                   /organism="Mus musculus"
FT                   /strain="Swiss"
FT                   /mol_type="mRNA"
FT                   /dev_stage="embryo"
FT                   /cell_type="neuron"
FT                   /tissue_type="brain (colliculus)"
FT                   /db_xref="taxon:10090"
FT   CDS             3..1094
FT                   /gene="5-HT4"
FT                   /product="serotonin 4 receptor"
FT                   /function="activates adenylyl cyclase"
FT                   /note="splice variant m5-HT4(f)"
FT                   /db_xref="GOA:P97288"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR001520"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:109246"
FT                   /db_xref="UniProtKB/Swiss-Prot:P97288"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="CAA09598.1"
FT                   /translation="MDKLDANVSSNEGFRSVEKVVLLTFLAVVILMAILGNLLVMVAVC
FT                   RDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQDIWAYGEMFCLVRTSLDVLLT
FT                   TASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVLPMFISFLPIMQGWNN
FT                   IGIVDVIEKRKFSHNSNSTWCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEH
FT                   AQQIQMLQRAGATSESRPQPADQHSTHRMRTETKAAKTLCVIMGCFCFCWAPFFVTNIV
FT                   DPFIDYTVPEQVWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYKRPPIL
FT                   GQTVPCSTTTINGSTHVLRPVPV"
XX
SQ   Sequence 1268 BP; 278 A; 341 C; 296 G; 353 T; 0 other;
     taatggacaa acttgatgct aatgtgagtt ccaacgaggg tttcaggtcc gtggagaagg        60
     tcgtgctgct cacgttcctt gcagtggtta tcctgatggc catcttgggc aacctgctgg       120
     tgatggtggc tgtgtgcagg gacaggcagc tcaggaaaat aaaaaccaac tatttcattg       180
     tgtctctcgc ctttgctgac ctgctggttt cggtgctggt gatgcccttt ggtgccattg       240
     agctggtcca agacatctgg gcttatgggg agatgttctg cctggtccgg acctctctgg       300
     atgtcctact caccacagca tcgatctttc acctgtgctg tatttccctg gacaggtatt       360
     acgccatctg ctgccagcct ttggtttata ggaacaagat gacccctcta cgcatcgcat       420
     taatgttggg aggctgctgg gtccttccca tgtttatatc ttttctcccc ataatgcaag       480
     gctggaacaa catcggcata gttgatgtga tagagaaaag gaaattcagc cacaactcta       540
     actccacgtg gtgtgtcttc atggtcaaca agccctatgc tatcacctgc tctgtggtgg       600
     ccttctacat cccgtttctc ctcatggtgc tggcctatta ccgaatctat gtcactgcta       660
     aggagcatgc ccagcagata cagatgttac aacgggcagg agccacctct gaaagcaggc       720
     cccagccagc tgaccagcac agcacacatc gcatgaggac agagaccaag gcagccaaga       780
     ctttatgtgt catcatgggc tgcttctgtt tctgctgggc ccccttcttt gtcaccaata       840
     ttgtggaccc tttcatagac tacactgtcc ccgagcaggt gtggactgct ttcctctggc       900
     ttggctatat caattcgggg ttgaaccctt ttctctatgc cttcttgaat aagtctttca       960
     gacgtgcctt cctcatcatc ctctgctgtg atgatgagcg ctacaaaaga ccccccattc      1020
     tgggccagac tgtcccctgt tcaaccacaa ccattaatgg atccacccat gtactaagac      1080
     ctgttcccgt ctaactgagc gtgctctgca aggctgtgta tacagttttg cacagtggcc      1140
     atcaccagga actggagaaa ttgcccatac acaatgaccc ggagtctctg gaatcatgct      1200
     tttgattgaa gacatggctt tccatttagc catccatccc catctgtgtc tgcatgaaca      1260
     ggttacta                                                               1268
//