Dbfetch

ID   AJ010949; SV 1; linear; mRNA; STD; MUS; 3710 BP.
XX
AC   AJ010949;
XX
DT   22-JAN-1999 (Rel. 58, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus mRNA for voltage gated calcium channel alpha-2-delta-C subunit
XX
KW   calcium channel alpha-2-delta-C subunit.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3710
RA   Klugbauer N.;
RT   ;
RL   Submitted (10-SEP-1998) to the INSDC.
RL   Klugbauer N., Institut fuer Pharmakologie und Toxikologie, Technische
RL   Universitaet Muenchen, Biedersteiner Str. 29, 80802, GERMANY.
XX
RN   [2]
RA   Klugbauer N., Lacinova L., Marais E., Hobom M., Hofmann F.;
RT   "Molecular diversity of the calcium channel alpha2delta subunit";
RL   J. Neurosci. 19:648-691(1999).
XX
DR   MD5; 83c3f7bc1c4f11ac49e2eac6f33849be.
DR   Ensembl-Gn; ENSMUSG00000021991; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0021096; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0021044; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0021021; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0021048; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020831; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021480; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020356; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0020798; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0020920; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0020904; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0020989; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020930; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021513; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0020104; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020411; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000022567; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0038647; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0038606; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0038571; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0038613; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0038356; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0039068; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0038361; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0038274; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0038417; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0038387; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0038508; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0038371; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0039113; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0037979; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0037761; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3710
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:10090"
FT   CDS             98..3373
FT                   /product="calcium channel alpha-2-delta-C subunit"
FT                   /db_xref="GOA:Q9Z1L5"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR013608"
FT                   /db_xref="InterPro:IPR013680"
FT                   /db_xref="MGI:MGI:1338890"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z1L5"
FT                   /protein_id="CAA09423.1"
FT                   /translation="MAGPGSLCCASRGASALLATALLYAALGDVVRSEQQIPLSVVKLW
FT                   ASAFGGEIKSIAAKYSGSQLLQKKYKEYEKDVAIEEIDGLQLVKKLAKIMEEMFHKKSE
FT                   AVRRLVEAAEEAHLKHEFDADLQYEYFNAVLINERDKDGNFLELGKEFILAPNDHFNNL
FT                   PVNISLSDVQVPTNMYNKDPAIVNGVYWSESLNKVFVDNFDRDPSLIWQYFGSAKGFFR
FT                   QYPGIKWEPDENGVIAFDCRNRKWYIQAATSPKDVVILVDVSGSMKGLRLTIAKQTVSS
FT                   ILDTLGDDDFFNIITYNEELHYVEPCLNGTLVQADRTNKEHFREHLDKLFAKGIGMLDI
FT                   ALNEAFNILSDFNHTGQGSICSQAIMLITDGAVDTYDTIFAKYNWPDRKVRIFTYLIGR
FT                   EAAFADNLKWMACANKGFFTQISTLADVQENVMEYLHVLSRPKVIDQEHDVVWTEAYID
FT                   STLPQAQKLADDQGLVLMTTVAMPVFSKQNETRSKGILLGVVGTDVPVKELLKTIPKYK
FT                   LGIHGYAFAITNNGYILTHPELRPLYEEGKKRRKPNYSSVDLSEVEWEDRDDVLRNAMV
FT                   NRKTGKFSMEVKKTVDKGKRVLVMTNDYYYTDIKGTPFSLGVALSRGHGKYFFRGNVTI
FT                   EEGLHDLEHPDVSLADEWSYCNTDLHPEHRHLSQLEAIKLYLKGKEPLLQCDKELIQEV
FT                   LFDAVVSAPIEAYWTSLALNKSENSDKGVEVAFLGTRTGLSRINLFVGAEQLTNQDFLK
FT                   AGDKENIFNADHFPLWYRRAAEQIAGSFVYSIPFSTGTVNKSNVVTASTSIQLLDERKS
FT                   PVVAAVGIQMKLEFFQRKFWTASRQCASLDGKCSISCDDETVNCYLIDNNGFILVSEDY
FT                   TQTGDFFGEVEGAVMNKLLTMGSFKRITLYDYQAMCRANKESSDSAHGLLDPYKAFLSA
FT                   AKWIMTELVLFLVEFNLCSWWHSDMTAKAQKLKQTLEPCDTEYPAFVSERTIKETTGNI
FT                   ACEDCSKSFVIQQIPSSNLFMVVVDSSCLCESVAPITMAPIEIRYNESLKCERLKAQKI
FT                   RRRPESCHGFHPEENARECGGASSLQAQAALLLLPLVSSLFSR"
XX
SQ   Sequence 3710 BP; 1017 A; 876 C; 938 G; 879 T; 0 other;
     gcgcggcgga gcaggcagcc cagcgcgctc gcccaccgcc cgcccggcgc agctctccgc        60
     ggccgctcca gtcgccgccg ccgccgccgc cgccaggatg gccgggccgg gctcgctgtg       120
     ctgcgcgtcc cggggggcct cggcgctcct agccaccgcg cttctctacg ccgctctggg       180
     ggacgtggtg cgctccgagc agcagatccc gctctccgta gtgaagctgt gggcctccgc       240
     ttttggtggg gagataaaat ccatcgctgc caagtactcg ggctcccagc ttctgcaaaa       300
     gaaatacaaa gagtatgaga aggacgttgc cattgaagaa atcgacggtc tccaactggt       360
     gaagaagttg gctaaaatca tggaggagat gttccacaag aagtccgagg cagtgaggcg       420
     tcttgtggag gctgcagagg aggcacacct gaaacatgaa tttgatgctg acttgcagta       480
     tgaatacttc aatgctgtgc tgatcaacga gagggacaaa gacgggaact ttttggaatt       540
     gggaaaggaa ttcatcttag cccccaatga ccattttaat aatttgcctg tgaacatcag       600
     tctgagtgat gtgcaagtgc caacgaacat gtacaacaaa gatcctgcca ttgtcaatgg       660
     agtgtattgg tctgaatctc taaacaaagt ttttgtggat aactttgatc gggatccgtc       720
     tctcatatgg cagtactttg gaagtgcaaa gggctttttc agacagtacc cagggattaa       780
     atgggaacca gatgagaatg gagtcattgc ctttgactgc aggaacagaa aatggtacat       840
     ccaggcagcg acttctccaa aggatgttgt cattttggtg gacgtcagtg ggagcatgaa       900
     aggactccgc ttgaccatcg ccaagcaaac agtgtcctca atactggata ctctgggtga       960
     tgatgacttc ttcaacatca tcacgtataa cgaagagctt cactatgtgg aaccttgtct      1020
     gaacggaaca ctggttcaag ctgacaggac caacaaggag cacttcaggg agcatttgga      1080
     caaacttttt gccaaaggga ttggaatgct ggatatcgca ctgaacgagg ccttcaacat      1140
     actgagcgat ttcaaccaca ctggacaagg aagcatttgc agccaggcca tcatgctcat      1200
     aactgatggg gcagtggaca cctatgatac catctttgca aaatataatt ggccagaccg      1260
     aaaggttcga atctttactt acctcattgg acgggaggct gcttttgccg acaatctcaa      1320
     gtggatggct tgtgctaaca aaggattttt cacccagatc tccaccttgg ctgatgtgca      1380
     ggaaaatgtc atggaatacc tccatgtgct tagccgacct aaagtcattg accaggagca      1440
     tgatgtggtg tggaccgaag cgtacattga cagcaccctc cctcaggctc aaaagcttgc      1500
     tgatgatcag ggcctcgtct tgatgaccac ggtggccatg cctgtgttta gtaagcagaa      1560
     cgaaactagg tcaaagggca ttcttctggg tgtggttggc acagatgtcc cagttaaaga      1620
     gcttctgaag accatcccca aatacaagtt aggaattcat ggttacgcct tcgccatcac      1680
     gaataatgga tatatcctga cgcacccgga gctcaggcca ctgtatgaag aaggaaaaaa      1740
     acggaggaaa cccaactaca gtagtgtgga tctctctgaa gtcgagtggg aagaccggga      1800
     tgatgtgtta cgaaatgcca tggtaaatcg gaagactggg aaattctcca tggaagtgaa      1860
     gaagaccgtg gacaaaggga aacgggtttt ggtgatgacc aatgactact actatacaga      1920
     catcaagggt actcctttca gtttaggtgt ggcgctctcc aggggccatg ggaaatactt      1980
     cttccgaggg aatgtaacca ttgaagaagg cctccatgac ttagaacatc ctgacgtgtc      2040
     cttggcagat gaatggtcct actgcaacac tgacctgcac ccagagcacc gccatctatc      2100
     tcaactggaa gccattaagc tctacctcaa aggcaaggag cctctgcttc aatgtgacaa      2160
     agaattgatt caagaagtcc tttttgatgc tgtggtgagc gcccctattg aagcctattg      2220
     gacgagcctg gccctcaaca aatctgagaa ttctgacaag ggtgtagagg tcgccttcct      2280
     cggcactcgc acaggcctct caagaatcaa cctgtttgtg ggggccgaac aactcaccaa      2340
     tcaggacttt ctgaaggctg gagacaaaga gaacattttt aatgccgatc atttccctct      2400
     ctggtacaga agagctgccg agcagatcgc aggaagcttt gtctattcca tccccttcag      2460
     cacaggaaca gtcaacaaaa gcaatgtggt gacagcaagt acctccatcc agctcctgga      2520
     tgagcggaaa tctcccgtgg tggcagctgt aggcattcag atgaaacttg aattcttcca      2580
     aaggaagttc tggactgcca gcagacagtg tgcctccctg gatggcaaat gctccataag      2640
     ctgcgatgac gagactgtga actgttacct tatagacaat aacggattca ttctggtgtc      2700
     tgaagactac acacagactg gagatttttt tggtgaggtg gaaggagctg tcatgaacaa      2760
     gttgttaaca atgggttcct ttaaaagaat aaccttgtac gactaccaag ccatgtgtag      2820
     agccaacaag gagagcagtg acagtgccca tggacttctg gacccctata aggcctttct      2880
     ctctgcagcc aagtggataa tgacggaact tgtcttgttc ctggtggagt ttaacctgtg      2940
     cagttggtgg cactccgaca tgacagctaa agcccagaaa ctgaaacaga ccctggaacc      3000
     ttgtgatact gaatacccag cctttgtttc tgaacgcacc atcaaggaga ccacagggaa      3060
     cattgcttgc gaagactgct ccaagtcctt cgtcatccag caaatcccga gtagcaatct      3120
     gttcatggtg gtggtggaca gtagctgtct ctgtgagtcc gtggctccta taaccatggc      3180
     acccattgaa atcaggtata atgaatccct taagtgtgaa cggttaaagg ctcagaagat      3240
     cagacgacgt ccagaatcct gccacggctt ccatcctgag gagaatgcaa gagagtgtgg      3300
     gggtgcatcg agtcttcagg cccaggcggc cttgctgctg ctgcccctgg tttcgagtct      3360
     cttctcaagg tgacactaac taatgggatg ttcttttggc atgctataaa tcatggataa      3420
     actgtgaacc caactatggt gcgacatagg agacataagc atagcccagc catcagcatc      3480
     tcatgatttt aaactgtgcg tgatagaaac tctaacaggt acattgacaa aaagttatct      3540
     ttttactttg ccagtcatgc aaatgtgaat ttgccacatg atcacccttc atcagaaatg      3600
     gggctgtact gggtaggcag tgtccttctg cttgaaaacc atggaaacca atttaaaact      3660
     gtgtactttt taaataaagt atattaaaat cataaaaaaa aaaaaaaaaa                 3710
//