Dbfetch

ID   AJ010731; SV 1; linear; mRNA; STD; MUS; 1987 BP.
XX
AC   AJ010731;
XX
DT   22-MAY-2000 (Rel. 63, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus mRNA for membrane-type-4 matrix metalloproteinase (MT4-MMP)
XX
KW   matrix metalloproteinase.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1987
RA   Lopez-Otin C.;
RT   ;
RL   Submitted (27-AUG-1998) to the INSDC.
RL   Lopez-Otin C., Universidad de Oviedo, Dpt. Biochemistry and Molecular
RL   Biology, C/ Julian Claveria, 6 Oviedo, 33006, SPAIN.
XX
RN   [2]
RX   DOI; 10.1074/jbc.275.19.14046.
RX   PUBMED; 10799478.
RA   English W.R., Puente X.S., Freije J.M.P., Knauper V., Amour A.,
RA   Merryweather A., Lopez-Otin C., Murphy G.;
RT   "Membrane type 4 matrix metalloproteinase (MMP17) has tumor necrosis
RT   factor-alpha convertase activity but does not activate pro-MMP2";
RL   J Biol Chem 275(19):14046-14055(2000).
XX
RN   [3]
RX   PUBMED; 8640782.
RA   Puente X.S., Pendas A.M., Llano E., Velasco G., Lopez-Otin C.;
RT   "Molecular cloning of a novel membrane-type matrix metalloproteinase from a
RT   human breast carcinoma";
RL   Cancer Res. 56(5):944-949(1996).
XX
DR   MD5; 9edf0a4cbc1a53d6a63b1292630d7cd1.
DR   Ensembl-Gn; ENSMUSG00000029436; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030126; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0030093; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0030027; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030103; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029820; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030556; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029229; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0029790; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0029940; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0029896; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0030029; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029927; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030597; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028943; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029303; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000031390; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0074610; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0074689; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0074590; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0074627; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0074261; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0075097; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0074811; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0074212; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0074350; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0074255; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0074411; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0074258; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0075330; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0074261; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0073386; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1987
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:10090"
FT   CDS             84..1820
FT                   /gene="MMP17"
FT                   /standard_name="MT4-MMP protein"
FT                   /product="membrane-type-4 matrix metalloproteinase"
FT                   /db_xref="GOA:Q9R0S3"
FT                   /db_xref="InterPro:IPR000585"
FT                   /db_xref="InterPro:IPR001818"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR006026"
FT                   /db_xref="InterPro:IPR018487"
FT                   /db_xref="InterPro:IPR021190"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR028726"
FT                   /db_xref="InterPro:IPR033739"
FT                   /db_xref="MGI:MGI:1346076"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9R0S3"
FT                   /protein_id="CAB92315.1"
FT                   /translation="MGRRPRGPGSPRGPGPPRPGPGLPPLLLVLALAAHGGCAAPAPRG
FT                   EDLSLGVEWLSRFGYLPPADPASGQLQTQEELSKAITAMQQFGGLETTGILDEATLALM
FT                   KTPRCSLPDLPPGAQSRRKRQTPPPTKWSKRNLSWRVRTFPRDSPLGRDTVRALMYYAL
FT                   KVWSDITPLNFHEVAGNAADIQIDFSKADHNDGYPFDGPGGTVAHAFFPGDHHTAGDTH
FT                   FDDDEPWTFRSSDAHGMDLFAVAVHEFGHAIGLSHVAAPSSIMQPYYQGPVGDPLRYGL
FT                   PYEDRVRVWQLYGVRESVSPTAQLDTPEPEEPPLLPEPPNNRSSTPPQKDVPHRCTAHF
FT                   DAVAQIRGEAFFFKGKYFWRLTRDRHLVSLQPAQMHRFWRGLPLHLDSVDAVYERTSDH
FT                   KIVFFKGDRYWVFKDNNVEEGYPRPVSDFSLPPGGIDAVFSWAHNDRTYFFKDQLYWRY
FT                   DDHTRRMDPGYPAQGPLWRGVPSMLDDAMRWSDGASYFFRGQEYWKVLDGELEAAPGYP
FT                   QSTARDWLVCGEPLADAEDVGPGPQGRSGAQDGLAVCSCTSDAHRLALPSLLLLTPLLW
FT                   GL"
FT   sig_peptide     84..200
FT                   /gene="MMP17"
FT   mat_peptide     456..1817
FT                   /gene="MMP17"
FT                   /product="membrane-type-4 matrix metalloproteinase"
XX
SQ   Sequence 1987 BP; 370 A; 632 C; 603 G; 382 T; 0 other;
     gaattccggg cggagccgag cgaggcgcgg agctggctgc tggcgggtgc ggggaccctc        60
     gccacccgac ctgggagagc gggatgggac gccgcccgcg gggacctggg tccccccggg       120
     gacctggccc tccacgcccc gggccggggc tgccaccact gctgcttgta ctggcgctgg       180
     cggcccatgg gggctgcgca gcgcccgcgc cccgcgggga ggacctcagc ctcggggtgg       240
     agtggctaag caggtttggc tacctgccgc ctgcagatcc ggcatcaggg cagctacaga       300
     cccaggagga actgtccaaa gcgattactg ccatgcagca gtttggtggt ctggagacca       360
     ctggcatcct agatgaggcc actctggccc tgatgaaaac ccctcgatgc tcccttccgg       420
     acctgccccc tggggcccaa tcgagaagga agcggcagac tccaccccca accaaatgga       480
     gcaagaggaa cctttcttgg agggtccgga cattcccacg ggactcaccc ctgggccggg       540
     atactgtgcg tgcactcatg tactacgccc tcaaagtctg gagtgacatc acacccttga       600
     acttccacga ggtagcgggc aacgcggcgg acatccagat cgacttctcc aaggccgacc       660
     acaatgacgg ctaccccttc gatggccctg gtggcacggt ggcccacgca ttcttccctg       720
     gtgaccacca cacggcaggg gacacccact ttgatgacga tgagccatgg accttccgtt       780
     cctcagatgc ccacgggatg gacctgtttg cagtggccgt ccatgagttt ggtcatgcca       840
     ttggtctgag ccatgttgcc gccccaagct ccatcatgca accgtactac cagggccccg       900
     tgggtgaccc gctacgctat ggacttccct atgaggacag ggtgcgtgtc tggcagttgt       960
     acggtgtgcg ggaatccgtg tcccctactg cccagctgga taccccagag cccgaggagc      1020
     cacccctcct gccagagccc cccaacaatc ggtctagcac tccgccccag aaggacgtgc      1080
     ctcacaggtg cactgcccac tttgatgctg tggcccagat tcgaggcgaa gcattctttt      1140
     tcaaaggcaa gtatttctgg aggctgaccc gggaccgaca cttggtgtcg ctgcagccgg      1200
     ctcaaatgca tcgcttctgg cggggcctgc cgctgcacct ggacagtgtg gacgctgtgt      1260
     atgagcgtac cagtgaccac aagattgtct tcttcaaagg agacagatac tgggtgttta      1320
     aggacaacaa cgtagaggaa gggtacccgc gacctgtctc cgacttcagc ctcccgccag      1380
     gtggcatcga tgctgtcttc tcctgggccc acaatgacag gacttatttc tttaaggacc      1440
     agctgtactg gcgctatgat gaccacacac ggcgcatgga ccctggctac cctgcccagg      1500
     gacccctgtg gagaggtgtc cccagcatgt tggatgatgc catgcgctgg tctgatggtg      1560
     catcctattt cttccgaggc caggagtact ggaaagtgct ggatggcgag ctggaagcag      1620
     cccccgggta cccacagtct acagcccgcg actggctggt atgcggtgag ccgctggcgg      1680
     atgcggagga tgtagggcct ggaccccagg gccgcagtgg ggcccaagat ggtctggcag      1740
     tatgttcctg cacttcagac gcacacaggt tggcactgcc atctctgctg cttctgactc      1800
     cactgctgtg gggcctgtga acctcagtct ctgccaaggc atcctgaggg cagtgctagc      1860
     cttgcggatc aaggagccaa ggggagcagg gacacactgg ccagtactca gcaggacttg      1920
     tgctccaagc ttccggtccc tcgctccttc cttccttcct tccttgaacc caggggctcc      1980
     ggaattc                                                                1987
//