spacer

EBI Dbfetch

ID   AJ010109; SV 1; linear; mRNA; STD; MUS; 2037 BP.
XX
AC   AJ010109;
XX
DT   06-AUG-1999 (Rel. 60, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus mRNA for membrane-associated adenylate kinase
XX
KW   adenylate kinase; ak1b gene; membrane-associated.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2037
RA   Collavin L.;
RT   ;
RL   Submitted (06-AUG-1998) to the INSDC.
RL   Collavin L., Laboratorio Nazionale, C.I.B., AREA Science Park, Padriciano
RL   99, Trieste, 34012, ITALY.
XX
RN   [2]
RX   DOI; 10.1038/sj.onc.1202970.
RX   PUBMED; 10557075.
RA   Collavin L., Lazarevic D., Utrera R., Marzinotto S., Monte M.,
RA   Schnedier C.;
RT   "wt p53 dependent expression of a membrane-associated isoform of adenylate
RT   kinase";
RL   Oncogene 18(43):5879-5888(1999).
XX
DR   MD5; 5be5234d7c73266101f3206a2cae04f7.
DR   Ensembl-Gn; ENSMUSG00000026817; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000068271; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113277; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113278; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2037
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /cell_line="Val5"
FT                   /cell_type="fibroblast"
FT                   /db_xref="taxon:10090"
FT   CDS             59..691
FT                   /gene="ak1b"
FT                   /product="membrane-associated adenylate kinase"
FT                   /db_xref="GOA:Q9R0Y5"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006267"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028582"
FT                   /db_xref="MGI:MGI:87977"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9R0Y5"
FT                   /protein_id="CAB52408.1"
FT                   /translation="MGCCVSSEPQEEGGRKTGEKLKKAKIIFVVGGPGSGKGTQCEKIV
FT                   QKYGYTHLSTGDLLRAEVSSGSERGKKLSAIMEKGELVPLDTVLDMLRDAMLAKVDSSN
FT                   GFLIDGYPREVKQGEEFEQKIGQPTLLLYVDAGAETMTQRLLKRGETSGRVDDNEETIK
FT                   KRLETYYNATEPVISFYDKRGIVRKVNAEGTVDTVFSEVCTYLDSLK"
XX
SQ   Sequence 2037 BP; 420 A; 543 C; 571 G; 503 T; 0 other;
     gccatggcag ggccaaagcc agagagaggg gaggtgacag cgggaacagg ataggatcat        60
     gggctgctgt gtgtctagtg aaccccaaga agagggaggc agaaagactg gagagaagct       120
     gaagaaggcc aagatcatct ttgtggtggg cggacctggc tcaggaaagg gcacccagtg       180
     cgagaagatt gtacagaaat atggctacac ccacctgtct actggggacc tgcttcgggc       240
     agaagtcagc tctggatcgg agaggggcaa gaagctgtcg gctatcatgg agaagggaga       300
     gctagtgcca ctggacacgg tgctggacat gctccgagat gctatgttag ccaaagtgga       360
     ttcttccaat ggcttcctga tcgacggcta cccgagggag gtgaaacagg gagaagaatt       420
     tgaacagaag attggacagc ccacactgct gctgtatgtg gacgcaggcg ccgagaccat       480
     gacccaacga ctcctgaagc gaggggagac cagtggccgc gtggatgaca acgaggagac       540
     catcaagaag cggctggaga cttattacaa tgccacagaa cctgtcatct ccttctatga       600
     caagcgtggc attgtgcgca aggtcaatgc cgaaggcacg gtggacactg tcttctctga       660
     ggtctgcacc tatcttgact ccctgaagta actggatccc ttggccagct cccagcccgc       720
     cccacccttg ctccctgacc ccaggcagcc tggctcaagc ccagcacctc caccctgccg       780
     ggctgtgcac agacacagga agccatgtta tcctgtccca tggacactaa agaaattgcc       840
     aaggagggtt aggattgctc ctttcctttg cttccagtta tggtgattca tgctgccaca       900
     gccggaggcc ccagcgtggc cggcccattc ttccctgtgc ctcagcccag ctgtcttgtc       960
     tccctctggc tctgctggga tcctaggccc ttccttagcc aggctgtgtc aaagcctagg      1020
     ggtccctggg ttggcaggct gctctggggg gtctggtgtt caccctgttt ctcatagcct      1080
     cgttgtgtgg ctttggccct aagccattgt ctctctggag tgagttttct ttttttcttt      1140
     ctttcttttt cttttttttc tttctctgtt tctttctttt tttttttttt tttaagacag      1200
     catctcgtgt gacttaagct ggcctcaacc ctgttatgta actaagggca accttaatcc      1260
     ttctgcctcc acttgtctcc ctgtgtgctg agattacagg tgtgtgtgtg gacctccacc      1320
     actctctgtt tttgggggca ctgggaatca agcccatgcc cctgtatacg aggccagcac      1380
     gctacagagt gagctgcatc ccgggctggg caggttttct gtgcctgact ggggtctggc      1440
     atgggcaaag ggcaaagggc catgggctca ccagctgggg ccacgtggtc actgggtgcc      1500
     aaggagctgt gcaatgggca tacagctagg tgggaagctg gggtcagggg tggccttcct      1560
     gaagaaggct cccttggtat agacctgcca ggccttgcca tcctttggct ggttttaaag      1620
     cttgtcctgt cacgctatgt cccaaccctt atcctcggcg ttaagacaag agcatgcaga      1680
     ttaaggagtg tgagctgcca tagacaagga tgtgggatca aggaccaggc ctgggacccg      1740
     gagaggacac ccagggatgc caagaagagc tggcatctct cttctgctct ttattctttg      1800
     gtctcattac acaggaagcc tctgtggtac tcacttgtcc tggggccccg tctccatccc      1860
     tagtgacttc ccctgtaagc ccagatagcc tgtaagccag cagccatggc tgtcccaggg      1920
     acacctgccc ctgggggtga cggtgctcac tcctttctgt ttactaccag tggggccacc      1980
     tttccttctg cattgcctat ttaagctgtc ctttaaaata aataaatgta tttcaga         2037
//


spacer
spacer