Dbfetch

ID   AJ010108; SV 1; linear; mRNA; STD; MUS; 1956 BP.
XX
AC   AJ010108;
XX
DT   06-AUG-1999 (Rel. 60, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus mRNA for cytosolic adenylate kinase
XX
KW   AK1 gene; cytosolic adenylate kinase.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1956
RA   Collavin L.;
RT   ;
RL   Submitted (06-AUG-1998) to the INSDC.
RL   Collavin L., Laboratorio Nazionale, C.I.B., AREA Science Park, Padriciano
RL   99, Trieste, 34012, ITALY.
XX
RN   [2]
RX   DOI; 10.1038/sj.onc.1202970.
RX   PUBMED; 10557075.
RA   Collavin L., Lazarevic D., Utrera R., Marzinotto S., Monte M.,
RA   Schnedier C.;
RT   "wt p53 dependent expression of a membrane-associated isoform of adenylate
RT   kinase";
RL   Oncogene 18(43):5879-5888(1999).
XX
DR   MD5; 23c4a92c9dd9c9edf2d55ecf272b36d4.
DR   Ensembl-Gn; ENSMUSG00000026817; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025615; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0025592; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0025562; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025589; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025349; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026033; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024811; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0025327; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0025460; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0025422; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0025546; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025453; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026091; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024559; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024880; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000068271; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113277; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113278; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0054169; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0054183; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0054143; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0054130; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053858; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054613; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0054028; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0053806; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0053916; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0053874; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0054020; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053865; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0054753; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053637; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0053132; mus_musculus_wsbeij.
DR   EuropePMC; PMC139566; 11751824.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1956
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /cell_line="Val5"
FT                   /cell_type="fibroblast"
FT                   /db_xref="taxon:10090"
FT   CDS             17..601
FT                   /gene="ak1"
FT                   /product="Adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /db_xref="GOA:Q9R0Y5"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006267"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028582"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="MGI:MGI:87977"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9R0Y5"
FT                   /protein_id="CAB52407.1"
FT                   /translation="MEEKLKKAKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRA
FT                   EVSSGSERGKKLSAIMEKGELVPLDTVLDMLRDAMLAKVDSSNGFLIDGYPREVKQGEE
FT                   FEQKIGQPTLLLYVDAGAETMTQRLLKRGETSGRVDDNEETIKKRLETYYNATEPVISF
FT                   YDKRGIVRKVNAEGTVDTVFSEVCTYLDSLK"
XX
SQ   Sequence 1956 BP; 402 A; 529 C; 532 G; 493 T; 0 other;
     cccagatctc agcaggatgg aagagaagct gaagaaggcc aagatcatct ttgtggtggg        60
     cggacctggc tcaggaaagg gcacccagtg cgagaagatt gtacagaaat atggctacac       120
     ccacctgtct actggggacc tgcttcgggc agaagtcagc tctggatcgg agaggggcaa       180
     gaagctgtcg gctatcatgg agaagggaga gctagtgcca ctggacacgg tgctggacat       240
     gctccgagat gctatgttag ccaaagtgga ttcttccaat ggcttcctga tcgacggcta       300
     cccgagggag gtgaaacagg gagaagaatt tgaacagaag attggacagc ccacactgct       360
     gctgtatgtg gacgcaggcg ccgagaccat gacccaacga ctcctgaagc gaggggagac       420
     cagtggccgc gtggatgaca acgaggagac catcaagaag cggctggaga cttattacaa       480
     tgccacagaa cctgtcatct ccttctatga caagcgtggc attgtgcgca aggtcaatgc       540
     cgaaggcacg gtggacactg tcttctctga ggtctgcacc tatcttgact ccctgaagta       600
     actggatccc ttggccagct cccagcccgc cccacccttg ctccctgacc ccaggcagcc       660
     tggctcaagc ccagcacctc caccctgccg ggctgtgcac agacacagga agccatgtta       720
     tcctgtccca tggacactaa agaaattgcc aaggagggtt aggattgctc ctttcctttg       780
     cttccagtta tggtgattca tgctgccaca gccggaggcc ccagcgtggc cggcccattc       840
     ttccctgtgc ctcagcccag ctgtcttgtc tccctctggc tctgctggga tcctaggccc       900
     ttccttagcc aggctgtgtc aaagcctagg ggtccctggg ttggcaggct gctctggggg       960
     gtctggtgtt caccctgttt ctcatagcct cgttgtgtgg ctttggccct aagccattgt      1020
     ctctctggag tgagttttct ttttttcttt ctttcttttt cttttttttc tttctctgtt      1080
     tctttctttt tttttttttt tttaagacag catctcgtgt gacttaagct ggcctcaacc      1140
     ctgttatgta actaagggca accttaatcc ttctgcctcc acttgtctcc ctgtgtgctg      1200
     agattacagg tgtgtgtgtg gacctccacc actctctgtt tttgggggca ctgggaatca      1260
     agcccatgcc cctgtatacg aggccagcac gctacagagt gagctgcatc ccgggctggg      1320
     caggttttct gtgcctgact ggggtctggc atgggcaaag ggcaaagggc catgggctca      1380
     ccagctgggg ccacgtggtc actgggtgcc aaggagctgt gcaatgggca tacagctagg      1440
     tgggaagctg gggtcagggg tggccttcct gaagaaggct cccttggtat agacctgcca      1500
     ggccttgcca tcctttggct ggttttaaag cttgtcctgt cacgctatgt cccaaccctt      1560
     atcctcggcg ttaagacaag agcatgcaga ttaaggagtg tgagctgcca tagacaagga      1620
     tgtgggatca aggaccaggc ctgggacccg gagaggacac ccagggatgc caagaagagc      1680
     tggcatctct cttctgctct ttattctttg gtctcattac acaggaagcc tctgtggtac      1740
     tcacttgtcc tggggccccg tctccatccc tagtgacttc ccctgtaagc ccagatagcc      1800
     tgtaagccag cagccatggc tgtcccaggg acacctgccc ctgggggtga cggtgctcac      1860
     tcctttctgt ttactaccag tggggccacc tttccttctg cattgcctat ttaagctgtc      1920
     ctttaaaata aataaatgta tttcagaaaa aaaaaa                                1956
//