Dbfetch

ID   AJ009947; SV 1; linear; mRNA; STD; HUM; 1078 BP.
XX
AC   AJ009947;
XX
DT   04-SEP-1998 (Rel. 56, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Homo sapiens mRNA for putative ATPase, partial
XX
KW   putative ATPase.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1078
RA   Romani M.;
RT   ;
RL   Submitted (30-JUL-1998) to the INSDC.
RL   Romani M., Population Genetics, Istituto Nazionale Ricerca sul Cancro,
RL   Largo Rosanna Benzi 10, 16132 Genova, ITALY.
XX
RN   [2]
RA   Casciano I., Volpi E.V., De Ambrosis A., Marchi J.M., Romani M.;
RT   "YAC analysis and genes identification at a site of viral integration in
RT   the 1p36.1-36.2 chromosomal site";
RL   Unpublished.
XX
DR   MD5; 2cbcc1c7e1a61c56447785be38e76067.
DR   Ensembl-Gn; ENSG00000159363; homo_sapiens.
DR   Ensembl-Tr; ENST00000326735; homo_sapiens.
DR   Ensembl-Tr; ENST00000341676; homo_sapiens.
DR   Ensembl-Tr; ENST00000452699; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1078
FT                   /organism="Homo sapiens"
FT                   /chromosome="1"
FT                   /map="p36.1-36.2"
FT                   /mol_type="mRNA"
FT                   /dev_stage="fetal"
FT                   /clone="PC15"
FT                   /cell_type="fibroblasts"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>809
FT                   /codon_start=3
FT                   /product="putative ATPase"
FT                   /db_xref="GOA:Q9NQ11"
FT                   /db_xref="H-InvDB:HIT000244365.13"
FT                   /db_xref="HGNC:HGNC:30213"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006544"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9NQ11"
FT                   /protein_id="CAA08912.1"
FT                   /translation="IPRAKTVLVCELQKLQYCVGMCGDGANDCGALKAADVGISLSQAE
FT                   ASVVSPFTSSMASIECVPMVIREGRCSLDTSFSVFKYMALYSLTQFISVLILYTINTNL
FT                   GDLQFLAIDLVITTTVAVLMSRTGPALVLGRVRPPGALLSVPVLSSLLLQMVLVTGVQL
FT                   GGYFLTLAQPWFVPLNRTVAAPDNLPNYENTVVFSLSSFQYLILAAAVSKGAPFRRPLY
FT                   TNERARPVPPRLPAPPPAQAGSKKRFKQLERELAEQPWPPLPAGPLR"
XX
SQ   Sequence 1078 BP; 193 A; 383 C; 300 G; 202 T; 0 other;
     gaattccgcg ggcaaagaca gtgctggtgt gcgagctaca gaagcttcag tactgcgtgg        60
     gcatgtgcgg agacggcgcc aatgactgtg gggccctgaa ggcggctgat gtcggcatct       120
     cgctgtccca ggcagaagcc tcagtggtgt cacccttcac ctcgagcatg gccagtattg       180
     agtgcgtgcc catggtcatc agggaggggc gctgttccct tgacacttca ttcagcgtct       240
     tcaagtacat ggctctgtac agcctgaccc agttcatctc cgtcctgatc ctctacacga       300
     tcaacaccaa cctgggtgac ctgcagttcc tggccatcga cctggtcatc accaccacag       360
     tggcagtgct catgagccgc acggggccag cgctggtcct gggacgggtg cggccaccgg       420
     gggcgctgct cagcgtgccc gtgctcagca gcctgctgct gcagatggtc ctggtgaccg       480
     gcgtgcagct agggggctac ttcctgaccc tggcccagcc atggttcgtg cctctgaaca       540
     ggacagtggc cgcaccagac aacctgccca actacgagaa caccgtggtc ttctctctgt       600
     ccagcttcca gtacctcatc ctggctgcag ccgtgtccaa gggggcgccc ttccgccggc       660
     cgctctacac caatgagcgt gctagaccag tgcctccccg cctgcctgcg ccgcctccgg       720
     cccaagcggg ctccaagaag cgcttcaagc agctggaacg agagctggcc gagcagccct       780
     ggccgccgct gcccgccggc cccctgaggt agtgcaggcc cacgggcacc ccagacactg       840
     gaactccctg cctctgagcc accaactgga cccctctcca gcaacaccac cgccaccacc       900
     tcccacatcc ctgaggttgg cgactgtcta cactcctccc ccgagaccac ccccaccctg       960
     gggaagcgtt gactactgtc ccctaccttg gaccatcccg cgtaggggtg gcagccccca      1020
     gctcccctca gtgctgctgt cagtgtagca aataaagtca tgatattttc cggaattc        1078
//