spacer

EBI Dbfetch

ID   AJ009823; SV 1; linear; mRNA; STD; MUS; 1810 BP.
XX
AC   AJ009823;
XX
DT   11-DEC-1998 (Rel. 58, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus mRNA for P2X7 receptor subunit
XX
KW   P2X7 gene; P2X7 receptor subunit.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1810
RA   Simon J.;
RT   ;
RL   Submitted (28-JUL-1998) to the INSDC.
RL   Simon J., Department of Pharmacology, University of Cambridge, Glaxo
RL   Institute of Applied Pharmacology, Tennis Court Road, Cambridge, CB2 1QJ,
RL   UNITED KINGDOM.
XX
RN   [2]
RA   Chessell I.P., Simon J., Hibell A.D., Michel A.D., Barnard E.A.,
RA   Humphrey P.P.A.;
RT   "Cloning and Functional characterisation of the mouse P2X7 receptor";
RL   FEBS Lett. 4390:260-300(1990).
XX
DR   MD5; 653639fb627c78a903a552d49807954e.
DR   Ensembl-Gn; ENSMUSG00000029468; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000100737; mus_musculus.
DR   EuropePMC; PMC2837825; 19838818.
DR   EuropePMC; PMC3844808; 18495881.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1810
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /cell_line="NTW8"
FT                   /cell_type="microglia"
FT                   /note="immortalised cell line"
FT                   /db_xref="taxon:10090"
FT   CDS             12..1799
FT                   /gene="P2X7"
FT                   /product="P2X7 receptor subunit"
FT                   /function="ATP gated ion channel"
FT                   /db_xref="GOA:Q9Z1M0"
FT                   /db_xref="InterPro:IPR001429"
FT                   /db_xref="InterPro:IPR003050"
FT                   /db_xref="InterPro:IPR027309"
FT                   /db_xref="MGI:MGI:1339957"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z1M0"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="CAA08853.1"
FT                   /translation="MPACCSWNDVFQYETNKVTRIQSTNYGTVKWVLHMIVFSYISFAL
FT                   VSDKLYQRKEPVISSVHTKVKGIAEVTENVTEGGVTKLGHSIFDTADYTFPLQGNSFFV
FT                   MTNYVKSEGQVQTLCPEYPRRGAQCSSDRRCKKGWMDPQSKGIQTGRCVPYDKTRKTCE
FT                   VSAWCPTEEEKEAPRPALLRSAENFTVLIKNNIHFPGHNYTTRNILPTMNGSCTFHKAW
FT                   DPQCSIFRLGDIFQEAGENFTEVAVQGGIMGIEIYWDCNLDSWSHHCRPRYSFRRLDDK
FT                   NMDESFVPGYNFRYAKYYKENNVEKRTLIKAFGIRFDILVFGTGGKFDIIQLVVYIGST
FT                   LSYFGLATVCIDLLINTYSSAFCRSGVYPYCKCCEPCTVNEYYYRKKCESIMEPKPTLK
FT                   YVSFVDEPHIRMVDQQLLGKSLQVVKGQEVPRPQMDFSDLSRLSLSLHDSPLTPGQSEE
FT                   IQLLHEEVAPKSGDSPSWCQCGNCLPSRLPEQRRALEELCCRRKPGRCITTSKLFHKLV
FT                   LSRDTLQLLLLYQDPLLVLGEEATNSRLRHRAYRCYATWRFGSQDMADFAILPSCCRWR
FT                   IRKEFPKTEGQYSGFKYPY"
XX
SQ   Sequence 1810 BP; 438 A; 490 C; 479 G; 403 T; 0 other;
     gaattcggct tatgccggct tgctgcagct ggaacgatgt ctttcagtat gagacaaaca        60
     aagtcacccg gatccagagc acgaattatg gcaccgtcaa gtgggtcttg cacatgatcg       120
     tcttttccta cattagcttt gctttggtga gcgataagct gtaccagcgg aaagagcctg       180
     ttatcagctc cgtgcacacc aaggtcaaag gcatagcaga ggtgacggag aatgtcacag       240
     agggtggggt gacgaagtta ggacacagca tctttgacac tgcagactac accttccctt       300
     tgcaggggaa ctcattcttt gtcatgacaa actatgtcaa gtcagaaggc caagtgcaga       360
     cgctgtgtcc tgagtatccc aggcgcggtg cacagtgctc ttctgaccgg cgttgtaaaa       420
     aggggtggat ggacccacag agcaaaggaa tccagactgg caggtgtgtt ccatatgaca       480
     agacaaggaa gacctgtgaa gtctctgcct ggtgtcctac tgaggaggag aaagaagctc       540
     cccgacctgc actcttgagg agcgccgaaa acttcaccgt actcatcaag aataatatcc       600
     acttccccgg ccacaactat accacgagaa acatcttgcc aactatgaac ggctcttgta       660
     cctttcacaa ggcttgggac cctcagtgtt ccatcttccg actaggggac atcttccagg       720
     aagcaggaga gaactttaca gaggtggcag ttcagggagg aatcatgggt atcgagatct       780
     actgggattg caacctagac agctggtccc atcactgccg acccaggtac agcttccgcc       840
     gcctggatga caagaacatg gatgagtcct tcgtccccgg ctacaacttc agatatgcca       900
     agtactataa ggagaacaat gtggaaaagc ggacgttgat caaagccttc ggcatccgtt       960
     ttgacatcct ggttttcggc actggaggaa aatttgacat catccagctg gttgtataca      1020
     ttggatccac cctgtcctac tttggcttgg ccactgtgtg cattgacttg ctcatcaaca      1080
     catactccag tgctttctgc aggtcggggg tttaccccta ctgtaagtgc tgtgagccct      1140
     gcacagtgaa cgagtattac tacagaaaga agtgtgagtc catcatggaa cccaagccga      1200
     cgttgaagta tgtgtccttt gtcgacgagc cgcacattcg catggtggac cagcagctgc      1260
     ttgggaaaag tctgcaagtt gtcaaaggcc aagaagttcc aagaccccag atggacttct      1320
     ccgacctgtc taggctgtcc ctatctctcc acgactcacc cctgactcct ggacaatctg      1380
     aggaaattca gctgctccat gaagaggtgg cccctaagtc cggggacagc ccgagttggt      1440
     gccagtgtgg aaattgcctc ccgtctcgcc taccggagca acgcagggcc ctggaggagc      1500
     tgtgctgccg gaggaagccg gggcggtgca tcaccacctc caagctcttc cataagctcg      1560
     tgctgtcccg agacaccctg cagctcctcc tgctttacca ggatcccttg ctggtgctgg      1620
     gggaagaggc caccaacagc aggctgcgac accgtgctta caggtgctat gccacctggc      1680
     gcttcggctc ccaggacatg gccgactttg ccattctgcc cagctgttgc cgctggagga      1740
     tccggaagga gttccccaag accgaggggc agtacagtgg cttcaagtat ccctactgaa      1800
     agccgaattc                                                             1810
//


spacer
spacer