spacer

EBI Dbfetch

ID   AJ006802; SV 1; linear; mRNA; STD; MUS; 129 BP.
XX
AC   AJ006802;
XX
DT   08-SEP-1998 (Rel. 56, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Mus musculus mRNA for neurexin I, partial
XX
KW   neurexin I.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-129
RA   Simons J.P.;
RT   ;
RL   Submitted (08-JUN-1998) to the INSDC.
RL   Simons J.P., Anatomy & Developmental Biology, Royal Free Hospital School of
RL   Medicine, Rowland Hill Street, London NW3 2PF, UK.
XX
RN   [2]
RP   1-129
RA   Gorecki D.C., Szklarczyk A., Lukasiuk K., Kaczmarek L., Simons J.P.;
RT   "Differential seizure-induced and developmental changes of neurexin
RT   expression";
RL   Unpublished.
XX
DR   MD5; 1efdc6cc48ad42c14e38655815eb29f9.
DR   Ensembl-Gn; ENSMUSG00000024109; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000054059; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000160844; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000161402; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000174331; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..129
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/10"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..>129
FT                   /codon_start=1
FT                   /product="neurexin I"
FT                   /db_xref="GOA:Q9CS84"
FT                   /db_xref="InterPro:IPR000152"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001791"
FT                   /db_xref="InterPro:IPR003585"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR027789"
FT                   /db_xref="MGI:MGI:1096391"
FT                   /db_xref="PDB:3BOD"
FT                   /db_xref="PDB:3MW2"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CS84"
FT                   /protein_id="CAA07257.1"
FT                   /translation="RNRDEGSYHVDESRNYISNSAQSNGAVVKEKQPSSAKSANKNK"
XX
SQ   Sequence 129 BP; 46 A; 29 C; 37 G; 17 T; 0 other;
     aggaaccggg atgaagggtc gtaccacgtg gatgagagtc gaaactacat cagtaactca        60
     gcacagtcca atggggctgt ggtcaaggag aagcaaccca gcagtgctaa aagcgccaac       120
     aaaaacaag                                                               129
//


spacer
spacer