Dbfetch

ID   AJ006802; SV 1; linear; mRNA; STD; MUS; 129 BP.
XX
AC   AJ006802;
XX
DT   08-SEP-1998 (Rel. 56, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Mus musculus mRNA for neurexin I, partial
XX
KW   neurexin I.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-129
RA   Simons J.P.;
RT   ;
RL   Submitted (08-JUN-1998) to the INSDC.
RL   Simons J.P., Anatomy & Developmental Biology, Royal Free Hospital School of
RL   Medicine, Rowland Hill Street, London NW3 2PF, UK.
XX
RN   [2]
RP   1-129
RA   Gorecki D.C., Szklarczyk A., Lukasiuk K., Kaczmarek L., Simons J.P.;
RT   "Differential seizure-induced and developmental changes of neurexin
RT   expression";
RL   Unpublished.
XX
DR   MD5; 1efdc6cc48ad42c14e38655815eb29f9.
DR   Ensembl-Gn; ENSMUSG00000024109; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024115; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0024075; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0024044; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024076; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023841; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024521; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023320; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0023814; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0023943; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0023909; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0024027; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023937; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024566; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023065; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023386; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000054059; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072671; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000160844; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000161402; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000174331; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000197268; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0048807; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0048784; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0048744; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0048746; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0048489; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0049238; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0048570; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0048416; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0048518; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0048487; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0048635; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0048491; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0049338; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0048169; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0047792; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..129
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/10"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..>129
FT                   /codon_start=1
FT                   /product="neurexin I"
FT                   /db_xref="GOA:Q9CS84"
FT                   /db_xref="InterPro:IPR000152"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001791"
FT                   /db_xref="InterPro:IPR003585"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR027789"
FT                   /db_xref="InterPro:IPR029824"
FT                   /db_xref="MGI:MGI:1096391"
FT                   /db_xref="PDB:3BOD"
FT                   /db_xref="PDB:3MW2"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CS84"
FT                   /protein_id="CAA07257.1"
FT                   /translation="RNRDEGSYHVDESRNYISNSAQSNGAVVKEKQPSSAKSANKNK"
XX
SQ   Sequence 129 BP; 46 A; 29 C; 37 G; 17 T; 0 other;
     aggaaccggg atgaagggtc gtaccacgtg gatgagagtc gaaactacat cagtaactca        60
     gcacagtcca atggggctgt ggtcaaggag aagcaaccca gcagtgctaa aagcgccaac       120
     aaaaacaag                                                               129
//