spacer

EBI Dbfetch

ID   AJ006074; SV 1; linear; mRNA; STD; MUS; 1660 BP.
XX
AC   AJ006074;
XX
DT   27-OCT-1998 (Rel. 57, Created)
DT   18-NOV-1998 (Rel. 57, Last updated, Version 3)
XX
DE   Mus musculus mRNA for G protein-coupled receptor EDG6
XX
KW   edg6 gene; G protein-coupled receptor.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1660
RA   Graeler M.H.;
RT   ;
RL   Submitted (11-MAY-1998) to the INSDC.
RL   Graeler M.H., Molekulare Tumor- und Immungenetik, Max-Delbrueck-Centrum,
RL   Robert-Roessle-Str. 10, 13122 Berlin, GERMANY.
XX
RN   [3]
RX   DOI; 10.1006/geno.1998.5491.
RX   PUBMED; 9790765.
RA   Graeler M.H., Bernhardt G., Lipp M.;
RT   "EDG6, a novel G protein-coupled receptor related to receptors for
RT   bioactive lysophospholipids, is specifically expressed in lymphoid tissue";
RL   Genomics 53(2):164-169(1998).
XX
DR   MD5; 510c5850fee9ae22e3a792af3c20696e.
DR   Ensembl-Gn; ENSMUSG00000044199; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000053646; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1660
FT                   /organism="Mus musculus"
FT                   /strain="BALB/c"
FT                   /mol_type="mRNA"
FT                   /cell_line="18"
FT                   /cell_type="dendritic"
FT                   /tissue_type="fetal skin-derived"
FT                   /db_xref="taxon:10090"
FT   CDS             500..1660
FT                   /gene="edg6"
FT                   /product="G protein-coupled receptor"
FT                   /db_xref="GOA:Q9Z0L1"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR004061"
FT                   /db_xref="InterPro:IPR004064"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1333809"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z0L1"
FT                   /protein_id="CAA06847.1"
FT                   /translation="MNISTWSTLVTPESCHRLAASGHSLLIVLHYNHSGRLASRGGSED
FT                   GGGLGMLRGPSVAAGCLVVLENAMVLAAIAIYMRSRRWVYYCLLNITLSDLLTGLAYVV
FT                   NVLLSGTRTFQLSPVHWFLREGLLFMALAASTFSLLFTAGERFATMVRVAESGATKTSR
FT                   VYGCIGLCWLLAAILGLLPLLGWNCVCAFPRCSSLLPLYSKGYVLFCVVVFALILVAIL
FT                   SLYGAIFRVVRANGQKSPRPPARRKSRRLLNTVLMILVAFVVCWGPLFGLLLADIFGSN
FT                   VWAQEYLRGMDWILALAVFNSAINPLIYSFRSREVQRAVLAFLCCGCLWLGLRGPGDCL
FT                   TRITEAHSGASTTDSSLRPRDSFRTSRSLSFRMREPLSSISSVRST"
FT   sig_peptide     500..610
FT                   /gene="edg6"
FT   mat_peptide     611..1657
FT                   /gene="edg6"
FT                   /product="G protein-coupled receptor EDG6"
XX
SQ   Sequence 1660 BP; 273 A; 525 C; 481 G; 381 T; 0 other;
     tttttcgaga cagggtttct ctgtgtagcc ctggctgtcc tggaactcac tttatagacc        60
     aggctggcct cgaactcaga aatccgcctg cctctgccta tggcacgctt tctgtgtaca       120
     gttgacaaat acttattagg cacctgctgt atatataagc atacagttgg aacagttggg       180
     cacaaggggg tgggcagagg gatcttggat gccaggctat gcccattgtc cagtagtgac       240
     tccccatcta gtgcttgcct cccatccaaa gagggaaatt tggtcctggg tggggtgcca       300
     tgagagatca tgctctctag ctcagagccc ccagagtcat acccacagtt gctcaggatg       360
     cccctccctg ccctggcctc acccccaccc actctggggc accttgagca taacaggaaa       420
     tttcaaacaa caggaaaccc aggccaggca gtgactccac cctgcggagg cctctctcag       480
     tctgtccccg gggggggcca tgaacatcag tacctggtcc acgctggtga ccccagagtc       540
     ctgccaccgg ctggcagcca gcggccacag cctcctcatt gtcctgcact acaatcacag       600
     cggcaggctg gccagccgcg ggggctctga ggacggtgga gggctaggga tgctgagggg       660
     gccgtcggtg gccgcaggtt gcctggtggt gctggagaac gccatggtgc tggccgccat       720
     cgccatctac atgcggtccc gccgctgggt gtactactgc ctgctgaaca tcacactgag       780
     tgacctgctc acaggcctgg cctacgtggt caacgtgctg ctgtcaggga ctcgtacctt       840
     ccagctgtca ccggtgcact ggttcctgcg ggagggcctg ctcttcatgg ccttggccgc       900
     atccaccttc agtctgctct tcacggccgg cgagcgcttc gccaccatgg tgcgggtggc       960
     tgagagtggg gccaccaaga ccagccgtgt gtatggctgc atcggtctgt gctggctact      1020
     ggcagctatc ctgggcctgc tgcccctgct gggctggaac tgtgtgtgcg ccttcccacg      1080
     ctgctccagc ctgctgcccc tctactccaa gggctatgtg ctcttttgtg tggtggtctt      1140
     cgccctcatc ctagtggcta tcctgagcct ctacggggcc atctttagag tggtccgagc      1200
     caatgggcag aagtctccac gtcctcctgc ccgccgcaag tcccgcaggc tactcaacac      1260
     cgtgctgatg atcttggtgg cctttgtggt gtgctggggt cccctgtttg gcctgctcct      1320
     ggctgacatc tttggttcta atgtctgggc ccaggagtac ctgcgtggca tggactggat      1380
     cctggccctg gccgtgttca actcagccat taatcctctc atctactcct tccgcagccg      1440
     tgaggtgcag cgcgctgtgc tggccttcct gtgctgcggc tgtctctggc taggtctgcg      1500
     aggtccagga gactgcctga cccggatcac cgaggcccac tccggtgcat ccaccactga      1560
     cagctccctg aggcccaggg acagttttcg gacttctcgg tcactcagct tcaggatgag      1620
     agagccgctg tccagcattt ccagcgtccg cagcacctag                            1660
//


spacer
spacer