spacer

EBI Dbfetch

ID   AJ001254; SV 1; linear; genomic DNA; STD; HUM; 246 BP.
XX
AC   AJ001254;
XX
DT   23-FEB-1998 (Rel. 54, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens HLA-DRB1 gene, exon 2, allele DRB1*13/DRB3*010/DQB1*0301
XX
KW   exon 2; HLA-DRB1.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-246
RA   Hashemi-tavoularis S.;
RT   ;
RL   Submitted (21-AUG-1997) to the INSDC.
RL   Hashemi-Tavoularis S., HLA section, Canadian Red Cross, 1800 Alta Vista
RL   Drive, Ottawa, ON, K1G 4J5, CANADA.
XX
RN   [2]
RA   Buyse I., Ouellet S., Hashemi-tavoularis S.;
RT   "Identification of novel DRB1*04, DRB1*13 and DRB1*15 alleles using the
RT   CANTYPE assay.";
RL   Unpublished.
XX
DR   MD5; 2abc27647b568737b35b226492db7d3f.
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
DR   Ensembl-Tr; ENST00000415796; homo_sapiens.
DR   Ensembl-Tr; ENST00000428566; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..246
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="p21.3"
FT                   /mol_type="genomic DNA"
FT                   /dev_stage="adult"
FT                   /cell_type="B-lymphocyte"
FT                   /tissue_type="blood"
FT                   /note="allele DRB1*13/DRB3*010/DQB1*0301"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>246
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /db_xref="GOA:Q5Y7A7"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*13:33:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /protein_id="CAA04628.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEYRAV
FT                   TELGRPSAEYWNSQKDILEDKRAALDNYCRHNYGVG"
XX
SQ   Sequence 246 BP; 55 A; 59 C; 85 G; 47 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctagcgc cgagtactgg aacagccaga       180
     aggacatcct ggaagacaag cgggccgcgc tggacaacta ctgcagacac aactacgggg       240
     ttggtg                                                                  246
//


spacer
spacer