Dbfetch

ID   AJ000328; SV 1; linear; mRNA; STD; MUS; 745 BP.
XX
AC   AJ000328;
XX
DT   08-JAN-1998 (Rel. 54, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Mus musculus mRNA for type 2 desmoglein
XX
KW   desmoglein type 2; DSG2 gene.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-745
RA   Buxton R.S.;
RT   ;
RL   Submitted (08-JUL-1997) to the INSDC.
RL   Buxton R.S., Division of Membrane Biology, National Institute for Medical
RL   Research, Mill Hill, London, NW7 1AA, UNITED KINGDOM.
XX
RN   [2]
RA   King I.A., Angst B.D., Hunt D.M., Kruger M., Arnemann J., Buxton R.S.;
RT   "Hierarchial expression of desmosomal cadherins during stratified
RT   epithelial morphogenesis in the mouse";
RL   Unpublished.
XX
DR   MD5; 57a39535e307f723893c391ac2571620.
DR   Ensembl-Gn; ENSMUSG00000044393; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059787; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..745
FT                   /organism="Mus musculus"
FT                   /chromosome="18"
FT                   /mol_type="mRNA"
FT                   /dev_stage="11 week"
FT                   /cell_type="skin"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..246
FT                   /codon_start=1
FT                   /gene="DSG2"
FT                   /product="Type 2 desmoglein"
FT                   /function="Cell-cell adhesion"
FT                   /db_xref="GOA:O55111"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR009122"
FT                   /db_xref="InterPro:IPR009123"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="InterPro:IPR027397"
FT                   /db_xref="MGI:MGI:1196466"
FT                   /db_xref="UniProtKB/Swiss-Prot:O55111"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="CAA03995.1"
FT                   /translation="AAGGQNVTVTERILTPASTLQSSYQIPSETSITARNTVLSSVGSI
FT                   GPLPNLDLEESDRPNSTITTSSTRVTKHSTMQHSYS"
XX
SQ   Sequence 745 BP; 230 A; 187 C; 156 G; 172 T; 0 other;
     gctgcaggag gacagaatgt caccgtgaca gaaagaatac taactcctgc ttccactctg        60
     cagtccagct accagattcc cagtgaaacc tccatcacgg ctaggaacac tgtgctctct       120
     agtgtgggaa gcataggtcc tctgcccaat ttagatctag aggaatctga tcgtcccaat       180
     tctactataa ccacatcttc caccagggtc accaagcata gcaccatgca acattcttac       240
     tcctaaagag aagccagccg cagtcggatc tggaccttaa ctagcatcca ctggatgtgt       300
     gtgtccatgc ccctaatgtt ataacagcca cacaagactt gcacattgga aaaacttatt       360
     gacatgccaa acaaagacac catgtctcag gtagggttgt atttcagcaa tgctctgtga       420
     ttattggggg atggagttaa gatgctagtt cctcagtgcc ttttagagta ctgtgcaagc       480
     aatactcgca aacaggacat gtaaaattga gttccaagaa cttacaaaac taaagcaggg       540
     tatctaattc atcaggtcca ggaggctggg tctctgcaca atgcattgat attcagcagg       600
     gacagttcca ccccttatat tacagagcca cacaggttat aggtaccaaa tagctcatcc       660
     acccagagac acatctccac tctttcatct ccactggaac cctgagtaca ccagagggaa       720
     gaaagaaaga aagaaagaga gagag                                             745
//