spacer

EBI Dbfetch

ID   AH012592; SV 2; linear; genomic DNA; STD; MUS; 3593 BP.
XX
AC   AH012592; AY158224-AY158227;
XX
DT   29-JUL-2011 (Rel. 109, Created)
DT   29-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Mus musculus receptor protein tyrosine phosphatase RO gene, partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3593
RA   Beltran P.J., Bixby J.L.;
RT   ;
RL   Submitted (03-OCT-2002) to the INSDC.
RL   Pharmacology, University of Miami, 1600 N.W. 10th Ave R-189, Miami, FL
RL   33129, USA
XX
DR   MD5; e55966871c118584c11f84815590f297.
DR   Ensembl-Gn; ENSMUSG00000030223; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000077115; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167002; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167679; mus_musculus.
XX
CC   On or before Jul 28, 2011 this sequence version replaced
CC   gi:28894437, gi:28894438, gi:28894439, gi:28894440, gi:28894436.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3593
FT                   /organism="Mus musculus"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   mRNA            join(<199..309,438..>514)
FT                   /product="receptor protein tyrosine phosphatase RO"
FT   5'UTR           join(<199..309,438..>514)
FT   exon            199..309
FT                   /number=11
FT   exon            438..>514
FT                   /number=12
FT   gap             515..614
FT                   /estimated_length=unknown
FT   mRNA            join(<669..801,1775..1895,3098..>3166)
FT                   /product="receptor protein tyrosine phosphatase RO"
FT   exon            669..801
FT                   /number=13
FT   5'UTR           <669..797
FT   CDS             join(798..801,1775..1895,3098..>3166)
FT                   /codon_start=1
FT                   /product="receptor protein tyrosine phosphatase RO"
FT                   /db_xref="GOA:Q80UH9"
FT                   /db_xref="UniProtKB/TrEMBL:Q80UH9"
FT                   /protein_id="AAO52748.1"
FT                   /translation="MVTEVNPNVVVISVLAILSTLLIGLLLVTLVILRKKHLQMARECG
FT                   AGTFVNFASLEREGKLPYS"
FT   gap             1646..1745
FT                   /estimated_length=unknown
FT   exon            1775..1895
FT                   /number=14
FT   gap             2612..2711
FT                   /estimated_length=unknown
FT   exon            3098..3166
FT                   /number=15
XX
SQ   Sequence 3593 BP; 876 A; 685 C; 773 G; 935 T; 324 other;
     ctcctcctct tcctcctcct cctcctcctc ctcctccttc ttcttcttct tctaattttg        60
     tgtctcactc aacaagttat gtgttgtcag gacaacacta gctccaggat ggatgacaca       120
     gaaactatta atagtctggt cacaaagctg aagcagagaa cagaaaacag aagtgtccaa       180
     aaggagtcac ttaaaacaca agtngggaag gacacaaaac attctgccgt tgtatgtaga       240
     tggcagtctt tgtgggtgga tgggcagatt caaatgcaat ataaaacaca ggctcttagc       300
     tacctgcctg tgagttctcc ggacatccnc cctgntanta ntaaaagagt gtgtgcacag       360
     ggcgtgtgtg tgtgtgtgtg tgtgtgtgtg tgtgtgtgtg tgngtgtgtg gtttttaata       420
     ttntgctttt ccctcagaac cagcccctcn gaagtcactc ttcgcagnga ncaaaacaca       480
     gacgtcagtg acccngctgt gggttnanga gggtnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       600
     nnnnnnnnnn nnnnatactt tcncaaacag aggaaggtgg aaatgtgttt tnttttntcc       660
     atccccagga nccagtagct gtgtcgtccc acgtggtgac catctccagc ctcctcccgg       720
     ccagtgccta caactgcagt gtcaccagct tcagcctcga cactcccagt gtccctacat       780
     tcatagctgt ctccacaatg ggtaatgata cggactgagc caatctggtc tttngaggtt       840
     tcttcattat tttttntttt agtatttcct tctcaataga tataacctgc tttttgatgg       900
     agccagtctt cctttgaaaa taccccaagc tacaggttca gggagccctt gactcctatc       960
     tcaaagtgtg cttggctaga acatgtgact tagaaaaaga ttcgtattgt cttcaagcat      1020
     tttttttaaa tgatatgtaa atataggata aaagagtatg aattttagat ttgggctatt      1080
     taggttcttc ctatgttcct gttaatgggt ataatcttct tgcctgcatg gatgtctgtg      1140
     caccgtgtac atgcctgctg ccacccgcca gagggcagaa gagagtatca gatccccgga      1200
     actggagcga gatggtagtg agcaagcatg tgggtgctga gaaacaaacc tgtacttggt      1260
     gcaaaaagca gttagtgttt ttaaccgctg aatcgtctct ccagctttag cttaatgttc      1320
     tttagaaaat tagaagtaaa aatacagaaa gccctaaagg tgtacaccag acacaaagcg      1380
     catccgccaa gagaaatcac caaggtgatc cttagactcc tcagcagggg tagacacagt      1440
     cctgaccaac acactctcat ctgtacaggc ccttggctgg ccgtggtcca atagcagtta      1500
     ccatttctac ttaaaatcaa agcaagaaag cctttacttc agccgtgcta aaaggcaaat      1560
     gggtgattac tgtggggtct ggaacagggc ttcttgttcc tttcctgtgg tatagcgtgt      1620
     tcattgtttg cagcaggaat tctagnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1680
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1740
     nnnnnctaga gcaacacgtg gcttctctct ctagttacag aggtgaaccc taacgtggtg      1800
     gtgatctcgg tgctggccat cctcagcaca cttttaattg gactgctctt agtgaccctt      1860
     gtcattctcc gaaagaagca cctgcagatg gctaggtaag aaaagtactg ttgtttgttc      1920
     atgtgtgtga gcatgcatat atgtgtgtgt ggttgtgtga tgatgataat gatgataacg      1980
     atgatgatga tgtgatgatg gaagccaggg ccttgtgtat tttaggcaag tactctacca      2040
     ctaggataaa cctcaagtcc tttttcttag acacattctc aactactttc ctcacattgc      2100
     agaataatct accagttttc tgaagacatt gatgcctgta aggcaaccac tgcatctgag      2160
     aaatttgctt caaacataga gttgaacagt tgcctatttc cagaaagaaa ataaaaggtg      2220
     tcttaattag gtttttatta ctatgaaaag ataccatgat catggcaact ctagtaaagg      2280
     aagatatttc actggggctg gctaacagtt tcagaggttt agtccattat cattgtggca      2340
     ggaaacatgg ttgcatgcag gcagacatgg tgctagagaa ggagctgaga gttctgcaac      2400
     ttgatccaca ggcagcagaa ggagactgtg tgccctactg ggtgtagctt gagcataaga      2460
     cacttcaaag ccctcgaccc cacataatga cacacttctt ccacaaggaa acatctcctc      2520
     atagtacaac tccttgtggg cccaaggatt gggagatgtg agtctggggg ggggggcatt      2580
     cttattcaac cacncagaaa acngaaaanc cnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2640
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2700
     nnnnnnnnnn ngttagggtc anccatggac atgcagatgt gtgttagggt caacagtggg      2760
     ggtacagatg tgtgttaggg tcaactatga aggtgcagat gtgtgttagg gtcagctatg      2820
     gcagcgcggg ttgtacatta gggtcatgaa cagtttgggn caaagggtgt gtgggatgac      2880
     tgttttggat ccaagagttt gatttgctac atctcattgg ctgtttcttt gtgttttagc      2940
     tttgtttttg gcattgtatg caagagagaa tcaaacaaaa catacattgc ccccttttta      3000
     atgctattct gataagctgg atccaaggcc ctccgccctt cgtgtcaggc aaagagctct      3060
     gtcaagtaat caccttgcgt ttgtctcttt caaacaggga atgtggagct ggcacgtttg      3120
     tcaactttgc atccttagaa agggaaggga aactccccta cagttggtga gtatgatacc      3180
     aagtcgcggc cccagacgct cgagctggcc agtacttgct tcaaattcga ttttattgta      3240
     aggcataggt gatttttctt ctggttgtcc tttatttcag tggttaatta atgactagat      3300
     catcatgggt cacaatcatt gctataaact gaatgggatt cttaagtaga ggaaaaaagg      3360
     gaaaataaag tcatcgtgca gagggtccaa agctgtgctt cgggctccag gaaaacagct      3420
     accataaaca agtggcagcc acaggcccac gggagccaac acatccattc aaatattaaa      3480
     taaaagtgtg cagcccaagg gtcttgcctc ttgtatcaaa gacagaggca aatatggaat      3540
     ttttatgatg cctttgtcat ttacaattgg aaaggaagtt cctagaagga aga             3593
//


spacer
spacer