spacer

EBI Dbfetch

ID   AH007277; SV 2; linear; genomic DNA; STD; HUM; 3970 BP.
XX
AC   AH007277; AF060834; AF076269-AF076273;
XX
DT   31-JUL-2011 (Rel. 109, Created)
DT   31-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens ubiquitin carboxy-terminal hydrolase L1 (UCHL1) gene, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3970
RX   DOI; 10.1038/26652.
RX   PUBMED; 9774100.
RA   Leroy E., Boyer R., Auburger G., Leube B., Ulm G., Mezey E., Harta G.,
RA   Brownstein M.J., Jonnalagada S., Chernova T., Dehejia A., Lavedan C.,
RA   Gasser T., Steinbach P.J., Wilkinson K.D., Polymeropoulos M.H.;
RT   "The ubiquitin pathway in Parkinson's disease";
RL   Nature 395(6701):451-452(1998).
XX
RN   [2]
RP   1-3970
RX   DOI; 10.1093/dnares/5.6.397.
RX   PUBMED; 10048490.
RA   Leroy E., Boyer R., Polymeropoulos M.H.;
RT   "Intron-exon structure of ubiquitin c-terminal hydrolase-L1";
RL   DNA Res. 5(6):397-400(1998).
XX
RN   [3]
RP   1-3970
RA   Leroy E.;
RT   ;
RL   Submitted (21-APR-1998) to the INSDC.
RL   LGDR, NIH, 49 Convent Drive, Bethesda, MD 20892, USA
XX
DR   MD5; 5738427f0572891610d97ff0df848ddb.
DR   Ensembl-Gn; ENSG00000154277; homo_sapiens.
DR   Ensembl-Tr; ENST00000284440; homo_sapiens.
DR   Ensembl-Tr; ENST00000503431; homo_sapiens.
XX
CC   On or before Jul 29, 2011 this sequence version replaced
CC   gi:4185713, gi:4185714, gi:4185715, gi:4185716, gi:4185717,
CC   gi:4185718, gi:4185719.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3970
FT                   /organism="Homo sapiens"
FT                   /chromosome="4"
FT                   /map="4p14"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <183..>3626
FT                   /gene="UCHL1"
FT   mRNA            join(<183..311,579..729,1171..1256,1332..1379,2211..2277,
FT                   2827..2885,3540..>3626)
FT                   /gene="UCHL1"
FT                   /product="ubiquitin carboxy-terminal hydrolase L1"
FT   CDS             join(<183..311,579..729,1171..1256,1332..1379,2211..2277,
FT                   2827..2885,3540..3626)
FT                   /codon_start=1
FT                   /gene="UCHL1"
FT                   /product="ubiquitin carboxy-terminal hydrolase L1"
FT                   /note="PGP9.5; neuron specific"
FT                   /db_xref="GOA:P09936"
FT                   /db_xref="HGNC:HGNC:12513"
FT                   /db_xref="InterPro:IPR001578"
FT                   /db_xref="PDB:2ETL"
FT                   /db_xref="PDB:2LEN"
FT                   /db_xref="PDB:3IFW"
FT                   /db_xref="PDB:3IRT"
FT                   /db_xref="PDB:3KVF"
FT                   /db_xref="PDB:3KW5"
FT                   /db_xref="PDB:4DM9"
FT                   /db_xref="PDB:4JKJ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P09936"
FT                   /protein_id="AAD09172.1"
FT                   /translation="VLSRLGVAGQWRFVDVLGLEEESLGSVPAPACALLLLFPLTAQHE
FT                   NFRKKQIEELKGQEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLGFEDGSVLKQFLS
FT                   ETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGR
FT                   MPFPVNHGASSEDTLLKDAAKVCREFTEREQGEVRFSAVALCKAA"
FT   exon            <183..311
FT                   /gene="UCHL1"
FT                   /number=3
FT   gap             430..529
FT                   /estimated_length=unknown
FT   exon            579..729
FT                   /gene="UCHL1"
FT                   /number=4
FT   gap             758..857
FT                   /estimated_length=unknown
FT   exon            1171..1256
FT                   /gene="UCHL1"
FT                   /number=5
FT   exon            1332..1379
FT                   /gene="UCHL1"
FT                   /number=6
FT   gap             1677..1776
FT                   /estimated_length=unknown
FT   exon            2211..2277
FT                   /gene="UCHL1"
FT                   /number=7
FT   gap             2494..2593
FT                   /estimated_length=unknown
FT   exon            2827..2885
FT                   /gene="UCHL1"
FT                   /number=8
FT   gap             3311..3410
FT                   /estimated_length=unknown
FT   exon            3540..3626
FT                   /gene="UCHL1"
FT                   /number=9
XX
SQ   Sequence 3970 BP; 863 A; 776 C; 826 G; 975 T; 530 other;
     gtgggccgcg ctttgtgctg tgtcattgcg ccggcccggg tgggggtggc agggcgggac        60
     tggggctcct cccaggctcg ggtgcgggcg cggagggcgc gcgcctcctg gccccgcccc       120
     ctggcaggtg cccgcgaccc gcgtgtcccc gtgcgcctgg ccgccttgtc tcctctccgc       180
     aggtgctgtc ccggctgggg gtcgccggcc agtggcgctt cgtggacgtg ctggggctgg       240
     aagaggagtc tctgggctcg gtgccagcgc ctgcctgcgc gctgctgctg ctgtttcccc       300
     tcacggccca ggtagggcgt ggggcccatg atgcgccggc cgccggcagt gcacgccgct       360
     ccccagcttg agtcctcggg ggctccccgc cccgccccct ccctgtaggt gatgcggggc       420
     gcgcctacan nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnt tccctgcact       540
     ctcattctga gatgtaaaaa cgctttttac attcgcagca tgagaacttc aggaaaaagc       600
     agattgaaga gctgaaggga caagaagtta gtcctaaagt gtacttcatg aagcagacca       660
     ttgggaattc ctgtggcaca atcggactta ttcacgcagt ggccaataat caagacaaac       720
     tgggatttgg tacgtgtggg tttagaggcc acccatcnnn nnnnnnnnnn nnnnnnnnnn       780
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnngct gtgaaaaagt gacaggagat ttgagagatg agtgaggtgg       900
     gagggaaaaa ggggtccngg gtagaaggga acagaggcaa gaaagacttg gcatattggg       960
     agagcggaga gacctntttg gcctgaaagc agtgaataga gaggggttag aaaaagaggn      1020
     taggggnaaa ggtacagctn atccacaacc ctggaggcag tattaaagat tcaggttgct      1080
     cagcatgttc agcnaaggct taagtcaacn ataaatatgt acccacttgt attattttac      1140
     ctatactaac acatccattt tttttttaag aggatggatc agttctgaaa cagtttcttt      1200
     ctgaaacaga gaaaatgtcc cctgaagaca gagcaaaatg ctttgaaaag aatgaggtaa      1260
     gagaacttac agagcatggc ctttaaataa ctctagagat ttttgtgcta attattttct      1320
     tttttccgca ggccatacag gcagcccatg atgccgtggc acaggaaggc caatgtcggg      1380
     taaatgcaaa tacaaatcgg agccaggctg cctgggtgcc atctgtgttt ctactgaaat      1440
     tgtgcaggaa tctcttactg gaacacagca aatgttatcc acccaaggcc aaatgacacc      1500
     agaaagttct acccaataat gctttgacta gacctgttca taaaaaaagt ttnctncaga      1560
     aattgtattg gtcattgaag tcttgagtaa attcaaattg acagtatttn gtttagatcc      1620
     aaatgagtct tataggtcag gcatagtggc tcatgcctgt aatcccaaca atttggnnnn      1680
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1740
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnagtg cttagtattg caggtgtgag      1800
     ccaccgtgcc tagccagatc tcagtgtctt tataactaca actggctgcc actnagtgct      1860
     tagtattgca ggtgtgagcc accgtgccta gccagatctc agtgtcttta taactacaac      1920
     tggctgccac tntctagcat tgaccttggt tgagatagtt agcctctcta agcctcaatt      1980
     ttctcctcag tnnaaatcct gtagtaatag catcctcata gagttgttct gacagttaac      2040
     agtatattta ccttagtggg cttagaatag ggcttaatgt aagacataca ttaaatatta      2100
     gctataattt ctaaaatcaa gtcagttcaa gcacatttca cttgaattgc aagataattt      2160
     ttaaaaatac agcttacact cattttcaaa aatttcttga ctttctttag gtagatgaca      2220
     aggtgaattt ccattttatt ctgtttaaca acgtggatgg ccacctctat gaacttggta      2280
     tgttttactc catttttgga acccagtgta gtttcatgtg ttctttcaga ctgaatttct      2340
     cttgatatat tgtgacttta tggcacttgg catatcattg tttataaagc cacaataaca      2400
     aagtattctc atgagggcac ttaacccctt atcatcccca gagcaacttc ctcaggcaac      2460
     tgactagcat cccctagtat catcctttct gggnnnnnnn nnnnnnnnnn nnnnnnnnnn      2520
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2580
     nnnnnnnnnn nnnagggtag ctgacttgag cttgtgcgat cttgtcaatt gtagactaga      2640
     attgcctggg atggatgcct agggacannn gaacctcant tgcagcctcc ngcttcataa      2700
     ccaggcttcc ttcngtgggt ttggcagtgg tttttggaag aatntaaaan ttccatctag      2760
     gctaggtaag cacggtagcc agaaaacatg cagagaaaat tgacatgcct ggcttctttg      2820
     ttacagatgg acgaatgcct tttccggtga accatggcgc cagttcagag gacaccctgc      2880
     tgaaggtcat ctttggaatg catctcttct taatgtgcct cacaattctt tggctaaatt      2940
     ttctattcta aagtctaaca ctcttccagt atagccagca tcagtngnct gggttaatan      3000
     cagtctgnag ggctgcaana tcctcttagt aactctatct accttatttt attgcaagtg      3060
     gttttaancn gggcttcana gacaccctga gtaatctgtt tcatgtgttg tctttaagtc      3120
     cacagttaga attagcctga aagctgttgc tttgcttcct ggtgggatta aggtgaccat      3180
     tgtcctccca tcagattaca tcatagctaa agactcacaa aacagcagcc tttcataatc      3240
     cctctaagac aacgggattt gggtcagtct tggaggtagt gtactataca ttctagtgag      3300
     gtggttaaat nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      3360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn caaattaatg      3420
     atggaattaa agttgatgag ggtgaacttt gagcattaat agaccttgga gcctttccct      3480
     atgtgacttt cattttgagc tcttgctgtt tggattttaa tgacatttct cctttccagg      3540
     acgctgccaa ggtgtgcaga gaattcaccg agcgtgagca aggagaagtc cgcttctctg      3600
     ccgtggctct ctgcaaggca gcctaatgct ctgtgggagg gactttgctg atttcccctc      3660
     ttcccttcaa catgaaaata tatacccccc atgcagtcta aaatgcttca gtacttgtga      3720
     aacacagctg ttcttctgtt ctgcagacac gccttcccct cagccacacc caggcactta      3780
     agcacaagca gagtgcacag ctgtccactg ggccattgtg gtgtgagctt cagatggtga      3840
     agcattctcc ccagtgtatg tcttgtatcc gatatctaac gctttaaatg gctactttgg      3900
     tttctgtctg taagttaaga ccttggatgt ggttatgttg tcctaaagaa taaattttgc      3960
     tgatagtagc                                                             3970
//


spacer
spacer