Dbfetch

ID   AH007066; SV 2; linear; genomic DNA; STD; MUS; 6594 BP.
XX
AC   AH007066; AF023340-AF023343;
XX
DT   29-JUL-2011 (Rel. 109, Created)
DT   29-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Mus musculus calcium/calmodulin-dependent 3',5'-cyclic nucleotide
DE   phosphodiesterase (PDE1B) gene, partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-6594
RX   DOI; 10.1007/s003359900820.
RX   PUBMED; 9657856.
RA   Reed T.M., Browning J.E., Blough R.I., Vorhees C.V., Repaske D.R.;
RT   "Genomic structure and chromosome location of the murine PDE1B
RT   phosphodiesterase gene";
RL   Mamm. Genome 9(7):571-576(1998).
XX
RN   [2]
RP   1-6594
RA   Repaske D.R., Reed T.M., Browning J.E.;
RT   ;
RL   Submitted (09-SEP-1997) to the INSDC.
RL   Division of Endocrinology, Children's Hospital Medical Center, University
RL   of Cincinnati, 3333 Burnet Avenue, Cincinnati, OH 45229-3039, USA
XX
DR   MD5; c75a90de68667df1b040dc16244683ee.
DR   Ensembl-Gn; ENSMUSG00000022489; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022444; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0022406; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0022381; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022410; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022177; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022859; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021703; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0022146; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0022277; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0022253; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0022346; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022275; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022871; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021443; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021753; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000023132; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042878; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0042843; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0042809; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042832; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0042567; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0043315; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042667; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0042479; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0042635; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0042595; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0042706; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042578; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0043355; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0042251; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041955; mus_musculus_wsbeij.
XX
CC   On or before Jul 28, 2011 this sequence version replaced
CC   gi:2564681, gi:2564682, gi:2564683, gi:2564684, gi:2564685.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..6594
FT                   /organism="Mus musculus"
FT                   /chromosome="15"
FT                   /map="15qter"
FT                   /strain="I129/SvJ"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            <1..>6594
FT                   /gene="PDE1B"
FT   intron          <1..291
FT                   /gene="PDE1B"
FT                   /note="intron A"
FT   mRNA            join(<292..405,1140..1322,1487..1553,1881..1997,2896..3036,
FT                   3386..3486,3578..3703,3824..3925,4751..4953,5249..5357,
FT                   5818..5948,6491..>6594)
FT                   /gene="PDE1B"
FT                   /product="calcium/calmodulin-dependent 3',5'-cyclic
FT                   nucleotide phosphodiesterase"
FT   CDS             join(<292..405,1140..1322,1487..1553,1881..1997,2896..3036,
FT                   3386..3486,3578..3703,3824..3925,4751..4953,5249..5357,
FT                   5818..5948,6491..6594)
FT                   /codon_start=2
FT                   /gene="PDE1B"
FT                   /product="calcium/calmodulin-dependent 3',5'-cyclic
FT                   nucleotide phosphodiesterase"
FT                   /db_xref="GOA:Q01065"
FT                   /db_xref="InterPro:IPR002073"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR013706"
FT                   /db_xref="InterPro:IPR023088"
FT                   /db_xref="InterPro:IPR023174"
FT                   /db_xref="MGI:MGI:97523"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q01065"
FT                   /protein_id="AAC96022.1"
FT                   /translation="LRYMVKQLENGEVNIEELKKNLEYTASLLEAVYIDETRQILDTED
FT                   ELRELRSDAVPSEVRDWLASTFTQQTRAKGRRAEEKPKFRSIVHAVQAGIFVERMFRRT
FT                   YTSVGPTYSTAVHNCLKNLDLWCFDVFSLNRAADDHALRTIVFELLTRHSLISRFKIPT
FT                   VFLMSFLEALETGYGKYKNPYHNQIHAADVTQTVHCFLLRTGMVHCLSEIEVLAIIFAA
FT                   AIHDYEHTGTTNSFHIQTKSECAILYNDRSVLENHHISSVFRMMQDDEMNIFINLTKDE
FT                   FAELRALVIEMVLATDMSCHFQQVKTMKTALQQLERIDKSKALSLLLHAADISHPTKQW
FT                   SVHSRWTKALMEEFFRQGDKEAELGLPFSPLCDRTSTLVAQSQIGFIDFIVEPTFSVLT
FT                   DVAEKSVQPLADDDSKPKSQPSFQWRQPSLDVDVGDPNPDVVSFRATWTKYIQENKQKW
FT                   KERAASGITNQMSIDELSPCEEEAPSSPAEDEHNQNGNLD"
FT   exon            292..405
FT                   /gene="PDE1B"
FT                   /number=2
FT   intron          406..>768
FT                   /gene="PDE1B"
FT                   /note="intron B"
FT   gap             769..868
FT                   /estimated_length=unknown
FT   intron          <869..1139
FT                   /gene="PDE1B"
FT                   /note="intron B"
FT   exon            1140..1322
FT                   /gene="PDE1B"
FT                   /number=3
FT   intron          1323..1486
FT                   /gene="PDE1B"
FT                   /note="intron C"
FT   exon            1487..1553
FT                   /gene="PDE1B"
FT                   /number=4
FT   intron          1554..1880
FT                   /gene="PDE1B"
FT                   /note="intron D"
FT   exon            1881..1997
FT                   /gene="PDE1B"
FT                   /number=5
FT   intron          1998..>2375
FT                   /gene="PDE1B"
FT                   /note="intron E"
FT   gap             2376..2475
FT                   /estimated_length=unknown
FT   intron          <2476..2895
FT                   /gene="PDE1B"
FT                   /note="intron E"
FT   exon            2896..3036
FT                   /gene="PDE1B"
FT                   /number=6
FT   intron          3037..3385
FT                   /gene="PDE1B"
FT                   /note="intron F"
FT   exon            3386..3486
FT                   /gene="PDE1B"
FT                   /number=7
FT   intron          3487..3577
FT                   /gene="PDE1B"
FT                   /note="intron G"
FT   exon            3578..3703
FT                   /gene="PDE1B"
FT                   /number=8
FT   intron          3704..3823
FT                   /gene="PDE1B"
FT                   /note="intron H"
FT   exon            3824..3925
FT                   /gene="PDE1B"
FT                   /number=9
FT   intron          3926..>4335
FT                   /gene="PDE1B"
FT                   /note="intron I"
FT   gap             4336..4435
FT                   /estimated_length=unknown
FT   intron          <4436..4750
FT                   /gene="PDE1B"
FT                   /note="intron I"
FT   exon            4751..4953
FT                   /gene="PDE1B"
FT                   /number=10
FT   intron          4954..5248
FT                   /gene="PDE1B"
FT                   /note="intron J"
FT   exon            5249..5357
FT                   /gene="PDE1B"
FT                   /number=11
FT   intron          5358..5817
FT                   /gene="PDE1B"
FT                   /note="intron K"
FT   exon            5818..5948
FT                   /gene="PDE1B"
FT                   /number=12
FT   intron          5949..6490
FT                   /gene="PDE1B"
FT                   /note="intron L"
FT   exon            6491..>6594
FT                   /gene="PDE1B"
FT                   /number=13
XX
SQ   Sequence 6594 BP; 1496 A; 1425 C; 1660 G; 1713 T; 300 other;
     aagctggacg ttgatgtgtg atccaagctc tctcctaggt gtatgagact gtgaacaata        60
     ctctcctgaa catcctcctg ggctgccaac tgcctaggct aaaactgctg ggggtatatt       120
     aactataggt agaagccaga gcctggaatg aaaaacactg actgctgctt gtcattaatg       180
     ttaggactat taacatctca gaagactgaa agtgtttgtg caaagtgccc ctaatggggg       240
     aaccccctga atggatgtag tgtctaagca ttctgtactt acaccctgca ggctgcgcta       300
     catggtgaag cagttggaga atggggaggt taacatcgag gagctgaaga aaaacctgga       360
     atacacagct tccctgctgg aagctgtcta cattgatgag acaaggtgag agaggcatgc       420
     agacggagaa ggaagatgtt agataggcag agcccagaga gggaggaggg cagggctgga       480
     atgagggctg cagacaaaga ggatggggca gagataaaga ggtggagaga tgctgagata       540
     gacaatgcct ggaaagggcc tggggtggag ctcaggggtg gagtgtttgc ttcacattcc       600
     tgacaccctg gcctaatacc cagtgacctg ggaaagacaa aggtaaaatc agtgatgcaa       660
     gggaccctag aaccatctag ttctaacctc acccacatga tacctcttag accgtgttgg       720
     ccaggagagg tgactctgtt ctattgctac tgaggactgt agtggtcann nnnnnnnnnn       780
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnntt taaattcata tgtgacctgt agttattctg       900
     atggctatgc tgccctgaga ctccctggaa aagtagtgtt cccctttgct aaggtcatgt       960
     ccatagtgat ctcacggcct tatacagtgt gttgcttcac tgttagagat gttccatagg      1020
     aagatagata caaagagctg tagtaaaata aaggaaaggt gaaaattgag caggagagac      1080
     actaagtggg tatagctggg tgcagggtct caagctgtga ctttccttct ggtcctcagg      1140
     caaatcctag acactgaaga tgagcttcgg gaacttcggt cagatgctgt gccttcagag      1200
     gtgcgggact ggttggcctc caccttcacc cagcagaccc gagccaaagg tcgcagggca      1260
     gaagagaaac ccaagttccg aagcatcgtg catgctgtgc aggctgggat cttcgtggag      1320
     cggtgaggtt tgcccattct caacctcccc ggcctctgtt gggccctctg tcccagtcag      1380
     gctaatcttt catgacccta cctaccctga gacttattcc cacagcccca attggccaaa      1440
     tttctgctcc cgaggctgtc cctgattttt ctatgttctt tctcaggatg ttccggagaa      1500
     cgtatacctc tgtgggcccc acatactcta ctgcagtcca caactgtctc aaggtgaccc      1560
     ctgggttttt gggaaagagg agaaggttgg gggttgaaat aaccattgag actaccagat      1620
     tttctgtttg tggtgtgggt tccccccccc cccttttaac tatttctatg ttcttctgga      1680
     caacttttac ttacccaaga ggcaaaccat tgtcttcttg tctctctggt actgagagat      1740
     acctgggttg aagaagaccc acataactac ctttgctttc ttgcttcatt gggaagtaca      1800
     cctggaagtc ttactgatct tgccatcgca agggagattt ggaggggagc tttcctgcct      1860
     agtccattgc ttttccacag aacctggacc tctggtgctt tgatgtcttt tccttgaacc      1920
     gggcagccga tgaccacgct ctgaggacca ttgtttttga gttgctgact cggcatagcc      1980
     tcatcagccg ctttaaggtt tggcagtgtt ctacctctac cttcaggcag gactcctcgc      2040
     tcctctttgc tctgtcctaa aagatttcca acgagtagtt ccctcatcct gtcccagtgt      2100
     caaggatgac acccctgccc atcccattct tgcaccccct gaaactgctg taatctggct      2160
     tctcacttca ctcactgctt ccagaggtat cagcctgtaa gtagttagct tgggatattg      2220
     ttcctttccc ttcctggtct gtccccttct agctggctgc catctgtctc cccttctgct      2280
     tctgtctgtg gactctggag gtctagagcc cagtgctgtc atcccttggg attagagtct      2340
     ctccatttgc tctgggggga agggaggggc cagaannnnn nnnnnnnnnn nnnnnnnnnn      2400
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2460
     nnnnnnnnnn nnnnncttag aatctccatg aataataatt atagatgctc tcagagagta      2520
     cttactaaat gcctgtactt tctcattaca tcctagttgg tagtagtatc tttatttgca      2580
     attaggaagg cacagaaaac atgtggttat ccaaggtcac acaggctgca ggtggtagag      2640
     cctgaatctg aactagcaga gccaatgcta gtcctttagg tcactcccaa ttctttttgg      2700
     ggagggtggg tgaatgaagt gaggtggagg tctccctgta gagtccactc tgacctggag      2760
     cttgcacacc ttttgcctca gccaagtgct gggataagag gtgagcatca tcacacctga      2820
     ctaccttgaa aagagtgctg ggattgcctg tctcattact cttgtggagc cttgatgtca      2880
     ctattcctcc tgtagattcc cacagtgttt ctgatgagtt ttctggaggc cttggagaca      2940
     ggctatggga aatataagaa tccttaccac aaccagatcc acgcagccga cgtgacccag      3000
     actgtccatt gcttccttct ccgcacaggc atggtggtag gtgcctggtc atgttcctga      3060
     tgttcagggc ctgtggatct agaactagga agccttggct gctctttcag tgccctttta      3120
     cttatactgt ttcctggaat tccaacatct tcagagtgaa attgcatcca cttcctccag      3180
     agagttccca ggtgtacttc ctgggcactg ctgggggcac atgatggggt gtagtgggca      3240
     tatgactggt ggggacagag gaaggtctct ggccattctg agagttgaaa cacatggcta      3300
     gctttgatga tgggtggagt gaggagatgt ctgggagtga ttggcagagt gctggcccta      3360
     cttcattttc ttcctcttcc cctagcactg cctgtcagag attgaggtct tggccatcat      3420
     ctttgctgca gccatccatg actatgagca cacaggcaca accaacagct tccacattca      3480
     gaccaagtga gcaatggggc atggcaggag caggaggggg ccaaagctgc cagaggagcc      3540
     ctttataggg ggctgggcat gacatacagc ttcacaggtc agaatgtgcc atcctgtaca      3600
     atgatcgatc ggtgctggag aatcaccaca tcagctctgt ctttcgaatg atgcaggatg      3660
     atgagatgaa catttttatc aatctcacca aggatgaatt tgcgtgagta caggccagca      3720
     tgtgccatcc ccgaaactct tatccaagcc ttcccccccc cccttatctt ttagtcctac      3780
     cccttgctga aaggactggt ctcttctctg tttgtccact tagagagctg cgggccctgg      3840
     ttatcgagat ggtgttggcc acagacatgt cctgccattt ccagcaagtg aagactatga      3900
     agacagcact gcagcagttg gaaaggtagc acacatggag ggatgtgggg cagggctaac      3960
     cccgagaaag ggccttgtga gtcagggtac aatgggcagt ggtatgcctg agttcttacc      4020
     tgggttcaga gactctcctg gctctaggca cttatctgag tatacatggg taagtgtgtg      4080
     tggtgtttgt gaatgtggcc ttggatttgt gtctaactgg tctgatggag ggcattgacc      4140
     aggaggagct tggatgggct tttattgtaa ttgtggaaca tgatttctct ggaatgttgg      4200
     gaaatacaat caatcttttt ggacatgtcc ttgctctgaa atggtaacag tgaagtgcct      4260
     ccctccacac aagctcctat tctagctact gggagagttg tgtgaggtta aaaagaacaa      4320
     atgaagacag gacaannnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      4380
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnactgg      4440
     gtacatatca tgtgtcagac acttgaaata cttgttataa gtcatttaat tctcagaaca      4500
     actcaatgtg tggcttctca tttttgtctt gaagaagatg aattatgaca ttttcagtaa      4560
     cttgcttagt gtctcacaac tagtgggtgg tagatatgag aaggagtcaa attcatgtcc      4620
     attgattcta agagagttat gtggaaatgt gtgtgtgtgt gtgtgtatgt gactggaagt      4680
     tggagaattg gccaaggttt ccttttccta gaagatcagc ttctttctct ttaacacatc      4740
     ccctaaccag gattgacaag tccaaggccc tatctcttct gcttcatgct gctgacatca      4800
     gccacccaac taagcagtgg tcagtccaca gccgctggac caaggcccta atggaagagt      4860
     tcttccgcca gggtgacaag gaggcagagc tgggcctgcc cttctctcca ctctgtgatc      4920
     gcacttccac attggtggcc cagtcccaga taggtgagtc tgagggaaga ggaaaggaga      4980
     tgtctgggct tggctaggcc tgttctgagc ctccaacccc ccgaactgct tttcttgctg      5040
     aggcaaggat gaagggctgg atggagcact ctggacaaag gagaaggatc tttctgggct      5100
     ctccaagttg ttcccaatgg gaaagctctt ccttcaagtc atttgtccag gccttgttat      5160
     ttgcaattgg gtctcacggc tgtgctccct ctctcctctc cctagctctc caagtgagac      5220
     atctttcctg attaagcact tcctgcaggt ttcattgact tcattgtgga gccaaccttc      5280
     tctgtgctga ctgatgtggc agaaaagagt gtccagccct tggcagatga tgattccaag      5340
     cctaaaagtc agcccaggtg actgtgactg gggtaaccat gtgtcctggc tcattgaatg      5400
     cagaggggac acctttatga gaagagacac aggctagaag gaggtgggag ggaggtaggc      5460
     tgctttaggt ttgagagcct ctctgcttgt tacaaaagga tgggactaga agggtgtgac      5520
     ttacacttag gcctccaaaa ttagttttcc ctttaagagt ctatgctgtc tttcagataa      5580
     tactgttttt gtttttcttc taccaggaca aaaagtgtgg agaaggaggg gtacagttgt      5640
     gggaagagag acaaggattt tgggggtcat ctagaagagg gaaaagagaa ctctgacccc      5700
     tcagcctttt attgatcttt tatctctatg ctgagggcta agaagtaggt tctgaagagg      5760
     gttgggtctt atatctggaa ttgggtgtgt gtatagagat tgcttgtcag ttcctagctt      5820
     ccagtggcgc cagccttctt tagatgtgga cgtaggagac cccaaccctg atgtggtcag      5880
     tttccgtgcc acctggacca agtacattca agagaacaaa cagaagtgga aggaacgggc      5940
     agcaagtggt gggtgctgtt atgtatgcac gtgtgtgaat atctaggact gactggcaaa      6000
     gcagtgggtg ctattgtgta tgcatgtgtg tgaacattct aggactgact ggcagagcaa      6060
     cagcaacccc cttcttgtta agtcccagga aactccttgg ctcctggagt tgggaatgga      6120
     accagtctgg ctaaaatagg aagccacagg aaaggctgtc tgaatgactt gggctgctct      6180
     agaacgagag ctgaagagat gataggacag ccatagtagt ctaagtcatg gactttgtgc      6240
     acatcacggt tgaccccttg tattctctaa ctgtctccaa atggtgcccc tagagatctg      6300
     ggtagcttgg tggtgctggc tgcaatgtgt gcgggggctg tgagtgttcc atgtgggaag      6360
     gggttcatgt agctcagttt tgaggcaggt ggtagatgag ggtcagtcct cttattttct      6420
     tcacatacac ctttggttct agagaaacta cttcttggcc taatatcaga tttcttggaa      6480
     ccctctgtag gcatcaccaa ccagatgtcc attgatgaac tgtccccctg tgaggaagaa      6540
     gccccatcct cccctgcaga agatgagcac aaccagaatg ggaatctgga ttag            6594
//