Dbfetch

ID   AF499445; SV 1; linear; genomic DNA; STD; HUM; 260 BP.
XX
AC   AF499445;
XX
DT   16-JUN-2003 (Rel. 76, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class I antigen (HLA-DRB1) gene, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-260
RA   Rodriguez-Marino S., Coquillard G.;
RT   "Characterization of a new DRB1*13011 variant allele";
RL   Unpublished.
XX
RN   [2]
RP   1-260
RA   Rodriguez-Marino S., Coquillard G.;
RT   ;
RL   Submitted (05-APR-2002) to the INSDC.
RL   Pathology, Children's Memorial Hospital, 2300 Children's Plaza, Box 262,
RL   Chicago, IL 60614, USA
XX
DR   MD5; 58bf597d0b672e7b70410470e1143470.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..260
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>260
FT                   /gene="HLA-DRB1"
FT   mRNA            <1..>260
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>260
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q5Y7A7"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*13:52"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5Y7A7"
FT                   /protein_id="AAP68877.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFHNQEEYVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDILEDERAAVDTYCRHNYGVVESFTV"
FT   exon            1..260
FT                   /gene="HLA-DRB1"
FT                   /number=2
XX
SQ   Sequence 260 BP; 55 A; 62 C; 92 G; 51 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc cataaccagg aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacatcct ggaagacgag cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg                                                   260
//