spacer

EBI Dbfetch

ID   AF498254; SV 1; linear; mRNA; STD; MUS; 1440 BP.
XX
AC   AF498254;
XX
DT   12-MAY-2002 (Rel. 71, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus strain ILS serotonin receptor mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1440
RX   DOI; 10.1007/s00335-001-1001-x.
RX   PUBMED; 11471062.
RA   Ehringer M.A., Thompson J., Conroy O., Xu Y., Yang F., Canniff J.,
RA   Beeson M., Gordon L., Bennett B., Johnson T.E., Sikela J.M.;
RT   "High-throughput sequence identification of gene coding variants within
RT   alcohol-related QTLs";
RL   Mamm. Genome 12(8):657-663(2001).
XX
RN   [2]
RP   1-1440
RA   Ehringer M.A., Thompson J., Conroy O., Xu Y., Yang F., Canniff J.,
RA   Beeson M., Gordon L., Bennett B., Johnson T.E., Sikela J.M.;
RT   ;
RL   Submitted (19-MAR-2002) to the INSDC.
RL   Pharmacology, University of Colorado Health Science Center, 4200 E. 9th Ave
RL   C236, Denver, CO 80262, USA
XX
DR   MD5; 04bb5bdfeb56ad76ae4ae4079271bb32.
DR   Ensembl-Gn; ENSMUSG00000026228; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027431; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1440
FT                   /organism="Mus musculus"
FT                   /strain="ILS"
FT                   /mol_type="mRNA"
FT                   /note="inbred long sleep mouse"
FT                   /db_xref="taxon:10090"
FT   CDS             1..1440
FT                   /codon_start=1
FT                   /product="serotonin receptor"
FT                   /db_xref="GOA:Q02152"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000482"
FT                   /db_xref="InterPro:IPR002231"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:109323"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02152"
FT                   /protein_id="AAM22971.1"
FT                   /translation="MASSYKMSEQSTTSEHILQKTCDHLILTNRSGLETDSVAEEMKQT
FT                   VEGQGHTVHWAALLILAVIIPTIGGNILVILAVALEKRLQYATNYFLMSLAIADLLVGL
FT                   FVMPIALLTIMFEAIWPLPLALCPAWLFLDVLFSTASIMHLCAISLDRYIAIKKPIQAN
FT                   QCNSRATAFIKITVVWLISIGIAIPVPIKGIETDVINPHNVTCELTKDRFGSFMVFGSL
FT                   AAFFAPLTIMVVTYFLTIHTLQKKAYLVKNKPPQRLTRWTVPTVFLREDSSFSSPEKVA
FT                   MLDGSHRDKILPNSSDETLMRRMSSVGKRSAQTISNEQRASKALGVVFFLFLLMWCPFF
FT                   ITNLTLALCDSCNQTTLKTLLEIFVWIGYVSSGVNPLIYTLFNKTFREAFGRYITCNYR
FT                   ATKSVKALRKFSSTLCFGNSMVENSKFFTKHGIRNGINPAMYQSPMRLRSSTIQSSSII
FT                   LLDTLLTENDGDKAEEQVSYI"
XX
SQ   Sequence 1440 BP; 387 A; 353 C; 300 G; 400 T; 0 other;
     atggcttcat cttataaaat gtctgaacaa agcacaactt ctgagcacat tttacagaag        60
     acatgtgatc acctgatcct gactaaccgt tctggattag agacagactc agtagcagag       120
     gaaatgaagc agactgtgga gggacagggg catacagtgc actgggcagc tctcctgata       180
     ctcgcggtga taatacccac cattggtggg aacatccttg tgattctggc tgttgcactg       240
     gagaaaaggc tgcagtacgc taccaactac tttttaatgt ccttggcgat agcagatttg       300
     ctggttggat tgtttgtgat gccgattgcc ctcttgacaa tcatgtttga ggctatatgg       360
     cccctcccac tggccctgtg tcctgcctgg ttattcctcg atgttctctt ttcaactgcc       420
     tccatcatgc atctctgtgc catttccctg gaccgctata tagccatcaa aaagccaatt       480
     caggccaatc agtgcaactc ccgggctact gcattcatca agattacagt ggtatggtta       540
     atttcaatag gcatcgccat cccagtccct attaaaggaa tcgagactga tgtgattaat       600
     ccacacaatg tcacctgtga gctgacaaag gaccgctttg gcagttttat ggtctttggg       660
     tcactggctg ctttcttcgc acctctcacc atcatggtag tcacttactt tctcaccatt       720
     cacactttac agaagaaagc ttacttggtc aaaaataagc cacctcaacg cctaacacgg       780
     tggactgtgc ccacagtttt cctaagggaa gactcatcct tttcatcacc agaaaaggtg       840
     gcaatgctgg atgggtctca cagggataaa attctaccta actcaagtga tgagacactt       900
     atgcgaagaa tgtcctcagt tggaaaaaga tcagcccaaa ccatttctaa tgagcagaga       960
     gcctcgaagg cccttggagt cgtgtttttc ctttttctgc ttatgtggtg cccctttttt      1020
     attacaaatc taactttagc tctgtgtgat tcctgcaatc agaccactct caaaacactc      1080
     ctggagatat ttgtgtggat aggctacgtt tcctcggggg tgaatcctct gatctataca      1140
     ctcttcaata agacatttcg ggaagcattt ggcaggtaca tcacctgcaa ttaccgagcc      1200
     acaaagtcag taaaagcact taggaagttt tccagtacac tttgttttgg gaattcaatg      1260
     gtagaaaact ctaaattttt cacaaaacat ggaattcgaa atgggatcaa ccctgccatg      1320
     taccagagcc caatgaggct ccgaagttca accattcagt cctcatcaat catcctcctc      1380
     gatacccttc tcactgaaaa cgatggcgac aaagcggaag agcaggtcag ctacatatag      1440
//


spacer
spacer