spacer

EBI Dbfetch

ID   AF498250; SV 1; linear; mRNA; STD; MUS; 3597 BP.
XX
AC   AF498250;
XX
DT   12-MAY-2002 (Rel. 71, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus strain ISS phospholipase C beta 1 mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3597
RX   DOI; 10.1007/s00335-001-1001-x.
RX   PUBMED; 11471062.
RA   Ehringer M.A., Thompson J., Conroy O., Xu Y., Yang F., Canniff J.,
RA   Beeson M., Gordon L., Bennett B., Johnson T.E., Sikela J.M.;
RT   "High-throughput sequence identification of gene coding variants within
RT   alcohol-related QTLs";
RL   Mamm. Genome 12(8):657-663(2001).
XX
RN   [2]
RP   1-3597
RA   Ehringer M.A., Thompson J., Conroy O., Xu Y., Yang F., Canniff J.,
RA   Beeson M., Gordon L., Bennett B., Johnson T.E., Sikela J.M.;
RT   ;
RL   Submitted (19-MAR-2002) to the INSDC.
RL   Pharmacology, University of Colorado Health Science Center, 4200 E. 9th Ave
RL   C236, Denver, CO 80262, USA
XX
DR   MD5; a1bb280fc4c431fab33d58976baff0a6.
DR   Ensembl-Gn; ENSMUSG00000051177; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070724; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110116; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3597
FT                   /organism="Mus musculus"
FT                   /strain="ISS"
FT                   /mol_type="mRNA"
FT                   /note="inbred short sleep mouse"
FT                   /db_xref="taxon:10090"
FT   CDS             1..3597
FT                   /codon_start=1
FT                   /product="phospholipase C beta 1"
FT                   /db_xref="GOA:Q9Z1B3"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000909"
FT                   /db_xref="InterPro:IPR001192"
FT                   /db_xref="InterPro:IPR001711"
FT                   /db_xref="InterPro:IPR009535"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR014815"
FT                   /db_xref="InterPro:IPR015359"
FT                   /db_xref="InterPro:IPR016280"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR028400"
FT                   /db_xref="MGI:MGI:97613"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z1B3"
FT                   /protein_id="AAM22967.1"
FT                   /translation="MAGAQPGVHALQLKPVCVSDSLKKGTKFVKWDDDSTIVTPIILRT
FT                   DPQGFFFYWTDQNKETELLDLSLVKDARCGKHAKAPKDPKLRELLDVGNIGHLEQRMIT
FT                   VVYGPDLVNISHLNLVAFQEEVAKEWTNEVFSLATNLLAQNMSRDAFLEKAYTKLKLQV
FT                   TPEGRIPLKNIYRLFSADRKRVETALEACSLPSSRNDSIPQEDFTPDVYRVFLNNLCPR
FT                   PEIDNIFSEFGAKSKPYLTVDQMMDFINLKQRDPRLNEILYPPLKQEQVQVLIEKYEPN
FT                   SSLAKKGQMSVDGFMRYLSGEENGVVSPEKLDLNEDMSQPLSHYFINSSHNTYLTAGQL
FT                   AGNSSVEMYRQVLLSGCRCVELDCWKGRTAEEEPVITHGFTMTTEISFKEVIEAIAECA
FT                   FKTSPFPILLSFENHVDSPKQQAKMAEYCRLIFGDALLMEPLEKYPLESGVPLPSPMDL
FT                   MYKILVKNKKKSHKSSEGSGKKKLSEQASNTYSDSSSVFEPSSPGAGEADTESDDDDDD
FT                   DDCKKSSMDEGTAGSEAMATEEMSNLVNYIQPVKFESFEISKKRNKSFEMSSFVETKGL
FT                   EQLTKSPVEFVEYNKMQLSRIYPKGTRVDSSNYMPQLFWNAGCQMVALNFQTVDLAMQI
FT                   NMGMYEYNGKSGYRLKPEFMRRPDKHFDPFTEGIVDGIVANTLSVKIISGQFLSDKKVG
FT                   TYVEVDMFGLPVDTRRKAFKTKTSQGNAVNPVWEEEPIVFKKVVLPSLACLRIAAYEEG
FT                   GKFIGHRILPVQAIRPGYHYICLRNERNQPLTLPAVFVYIEVKDYVPDTYADVIEALSN
FT                   PIRYVNLMEQRAKQLAALTLEDEEEVKKEADPGETSSEAPSETRTTPAENGVNHTASLA
FT                   PKPPSQAPHSQPAPGSVKAPAKTEDLIQSVLTEVEAQTIEELKQQKSFVKLQKKHYKEM
FT                   KDLVKRHHKKTTELIKEHTTKYNEIQNDYLRRRAALEKSAKKDSKKKSEPSSPDHGSSA
FT                   IEQDLAALDAEMTQKLIDLKDKQQQQLLNLRQEQYYSEKYQKREHIKLLIQKLTDVAEE
FT                   CQNNQLKKLKEICEKEKKELKKKMDKKRQEKITEAKSKDKSQMEEEKTEMIRSYIQEVV
FT                   QYIKRLEEAQSKRQEKLVEKHNEIRQQILDEKPKLQTELEQEYQDKFKRLPLEILEFVQ
FT                   EAMKGKISEDSNHGSAPPSLASDAAKVNLKWS"
XX
SQ   Sequence 3597 BP; 1117 A; 817 C; 903 G; 760 T; 0 other;
     atggctgggg ctcagcccgg agtgcacgcc ttgcaactca agcccgtgtg cgtgtccgac        60
     agcctcaaga agggcaccaa attcgtcaag tgggatgatg actccactat tgttactcca       120
     attattttga ggactgatcc tcagggattt ttcttttact ggacagacca gaataaggag       180
     acggagctgt tagatctcag ccttgtcaag gatgccaggt gtgggaagca cgccaaagct       240
     cccaaggacc ccaagttgcg tgaacttctg gatgttggga acatcggaca cttggaacag       300
     cgcatgataa ctgtggtgta tggaccagac ctggtgaaca tttcccactt gaatcttgtg       360
     gcttttcaag aggaagtagc caaggaatgg acaaatgagg ttttcagctt ggcaacaaac       420
     ctgctggctc agaacatgtc cagggacgca tttctggaga aagcatatac taagctcaag       480
     ctccaggtca ccccagaagg ccgcattcct cttaaaaaca tctatcgatt gttctcagca       540
     gaccggaagc gcgttgaaac tgcactagag gcttgtagtc ttccatcttc gaggaatgac       600
     tccattcccc aagaggactt cactccagat gtatacagag ttttcctgaa caatctctgt       660
     ccccgacctg aaattgataa catcttttct gaatttggtg ccaaaagcaa accgtacctg       720
     acggttgatc agatgatgga ttttatcaac cttaagcaga gagatccccg gctcaatgaa       780
     atcctttacc cacctctgaa gcaggagcag gtccaagtgt tgattgagaa atatgagccc       840
     aacagcagcc tcgccaagaa agggcagatg tcagtggatg gattcatgcg ctacctgagc       900
     ggagaagaaa atggagtcgt ttcacctgag aaactggatt tgaacgaaga catgtctcag       960
     cccctgtctc actatttcat caattcctcg cacaacacct acctcacagc tggccagttg      1020
     gctgggaact cgtctgtaga gatgtatcgc caggtgcttc tgtctggatg tcgctgtgtg      1080
     gagctggact gctggaaggg aaggaccgct gaggaagagc ctgtcattac ccatggattc      1140
     accatgacaa cagaaatatc cttcaaggaa gtcatagaag ccatcgcaga gtgtgcgttc      1200
     aagacgtctc ctttccccat cctcctttcc tttgagaacc acgtggattc cccgaagcaa      1260
     caagccaaga tggccgagta ttgccgatta atctttggtg atgccctcct gatggaacca      1320
     ctggaaaaat acccactgga atctggggta cctcttccaa gccctatgga tttaatgtat      1380
     aaaatcttgg tgaaaaacaa gaagaagtcg cacaagtcgt cagagggaag tggtaagaag      1440
     aagctttctg agcaagcttc caacacctac agcgactcct ccagtgtgtt cgagccttcg      1500
     tctccaggag ctggggaagc agatacggag agtgatgacg atgacgacga cgatgactgt      1560
     aaaaagtctt ccatggatga ggggacagct ggcagcgaag ccatggccac agaagagatg      1620
     tctaacctgg tgaactatat tcagcctgtc aagtttgagt cctttgaaat ttcaaaaaaa      1680
     agaaataaaa gctttgaaat gtcttccttc gtggaaacca aaggacttga acaacttaca      1740
     aagtctccgg tggaatttgt agaatacaac aagatgcaac ttagcaggat atatcccaag      1800
     ggaacacgtg tggattcatc caactacatg cctcaactct tctggaatgc tggctgtcag      1860
     atggtggcgc tcaacttcca gactgtggat ctagctatgc agataaacat gggcatgtat      1920
     gagtacaatg ggaagagcgg ctataggctg aagccagagt tcatgaggag gccggacaag      1980
     cattttgatc catttactga aggaatcgta gatgggatag tggccaacac tctatctgtt      2040
     aagattattt caggtcagtt cctctctgat aagaaagttg ggacttatgt ggaagtggat      2100
     atgtttggct tgcctgtgga cacaaggagg aaggcattta aaaccaagac atcccaagga      2160
     aatgctgtaa accctgtctg ggaagaagaa cctattgtat tcaaaaaggt agttctacct      2220
     tctctggcct gtttgaggat agcagcatat gaagagggag gcaaatttat tggccaccgg      2280
     atattgcctg tgcaggctat tcggccaggc tatcactaca tctgcctgcg gaatgagagg      2340
     aaccagcccc tgacgctgcc agctgtcttt gtctacatag aagtcaaaga ctatgtgcca      2400
     gacacgtatg cagatgtaat cgaagctcta tcaaacccaa tccgatatgt caatctgatg      2460
     gaacagagag ctaagcagct ggctgcgttg accctggagg atgaagagga agtaaagaag      2520
     gaggctgacc ctggagaaac atcttccgag gctccaagcg aaaccaggac aacgccagca      2580
     gagaatgggg tgaatcacac cgcatccctt gcacccaagc cgccttccca ggctccacac      2640
     agccagcctg ctccagggtc tgtgaaggca cctgccaaaa cagaagatct gatccagagc      2700
     gtgttaacag aagtagaggc gcaaaccatt gaagagctca agcaacagaa atcgttcgtg      2760
     aaacttcaaa agaaacacta caaagaaatg aaagacctgg tgaagagaca ccacaagaaa      2820
     accacggaac tcattaagga gcacacaacc aagtacaacg agattcagaa tgactacctg      2880
     agaaggaggg cagccttgga gaagtccgcc aaaaaggaca gcaagaagaa atctgaaccc      2940
     agcagccctg accacggctc atcagccatt gagcaagacc tcgctgccct ggatgcagaa      3000
     atgactcaga agttgataga cttgaaagac aagcaacaac agcagctgct taatcttcgg      3060
     caagagcagt attacagcga gaagtaccaa aagcgagaac acattaaact gcttattcag      3120
     aagttgacag atgttgcaga agagtgtcag aacaatcagt taaagaagct gaaggaaatc      3180
     tgcgagaaag agaagaagga attaaagaag aaaatggata agaagaggca agagaagata      3240
     acagaagcca agtccaaaga caaaagccag atggaagagg agaagacaga gatgatccga      3300
     tcgtacatcc aggaggtggt tcagtacatc aagaggttag aggaagcaca aagtaaaaga      3360
     caagaaaaac tcgtggagaa acacaatgag atccgccagc agatcctcga tgagaagccc      3420
     aagctgcaga cggagctgga gcaagaatac caagacaagt tcaaaaggct gcccctggag      3480
     attctggagt ttgtacagga agccatgaaa gggaagatca gcgaggacag caatcacggc      3540
     tctgcccctc cctctctggc ctcagatgct gcaaaggtga acctcaagtg gtcatag         3597
//


spacer
spacer