spacer

EBI Dbfetch

ID   AF477983; SV 1; linear; mRNA; STD; MUS; 1615 BP.
XX
AC   AF477983;
XX
DT   04-MAR-2002 (Rel. 71, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus strain C57BL/6J interleukin 21 receptor (Il21r) mRNA, complete
DE   cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1615
RA   Gao J., Teuscher C.;
RT   "Mus musculus interleukin 21 receptor gene Il21r mRNA";
RL   Unpublished.
XX
RN   [2]
RP   1-1615
RA   Gao J., Teuscher C.;
RT   ;
RL   Submitted (29-JAN-2002) to the INSDC.
RL   Medicine and Immunobiology, The University of Vermont, 149 Beaumont Avenue,
RL   Burlington, VT 05405, USA
XX
DR   MD5; f45a25f044013838350cf4883e37af2e.
DR   Ensembl-Gn; ENSMUSG00000030745; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033000; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1615
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /tissue_type="spleen"
FT                   /db_xref="taxon:10090"
FT   CDS             17..1606
FT                   /codon_start=1
FT                   /gene="Il21r"
FT                   /product="interleukin 21 receptor"
FT                   /note="IL21R"
FT                   /db_xref="GOA:Q9JHX3"
FT                   /db_xref="InterPro:IPR003531"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="MGI:MGI:1890475"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JHX3"
FT                   /protein_id="AAL82633.1"
FT                   /translation="MPRGPVAALLLLILHGAWSCLDLTCYTDYLWTITCVLETRSPNPS
FT                   ILSLTWQDEYEELQDQETFCSLHRSGHNTTHIWYTCHMRLSQFLSDEVFIVNVTDQSGN
FT                   NSQECGSFVLAESIKPAPPLNVTVAFSGRYDISWDSAYDEPSNYVLRGKLQYELQYRNL
FT                   RDPYAVRPVTKLISVDSRNVSLLPEEFHKDSSYQLQVRAAPQPGTSFRGTWSEWSDPVI
FT                   FQTQAGEPEAGWDPHMLLLLAVLIIVLVFMGLKIHLPWRLWKKIWAPVPTPESFFQPLY
FT                   REHSGNFKKWVNTPFTASSIELVPQSSTTTSALHLSLYPAKEKKFPGLPGLEEQLECDG
FT                   MSEPGHWCIIPLAAGQAVSAYSEERDRPYGLVSIDTVTVGDAEGLCVWPCSCEDDGYPA
FT                   MNLDAGRESGPNSEDLLLVTDPAFLSCGCVSGSGLRLGGSPGSLLDRLRLSFAKEGDWT
FT                   ADPTWRTGSPGGGSESEAGSPPGLDMDTFDSGFAGSDCGSPVETDEGPPRSYLRQWVVR
FT                   TPPPVDSGAQSS"
XX
SQ   Sequence 1615 BP; 356 A; 450 C; 453 G; 356 T; 0 other;
     aggtctggga cacagcatgc cccggggccc agtggctgcc ttactcctgc tgattctcca        60
     tggagcttgg agctgcctgg acctcacttg ctacactgac tacctctgga ccatcacctg       120
     tgtcctggag acacggagcc ccaaccccag catactcagt ctcacctggc aagatgaata       180
     tgaggaactt caggaccaag agaccttctg cagcctacac aggtctggcc acaacaccac       240
     acatatatgg tacacgtgcc atatgcgctt gtctcaattc ctgtccgatg aagttttcat       300
     tgtcaatgtg acggaccagt ctggcaacaa ctcccaagag tgtggcagct ttgtcctggc       360
     tgagagcatc aaaccagctc cccccttgaa cgtgactgtg gccttctcag gacgctatga       420
     tatctcctgg gactcagctt atgacgaacc ctccaactac gtgctgaggg gcaagctaca       480
     atatgagctg cagtatcgga acctcagaga cccctatgct gtgaggccgg tgaccaagct       540
     gatctcagtg gactcaagaa acgtctctct tctccctgaa gagttccaca aagattctag       600
     ctaccagctg caggtgcggg cagcgcctca gccaggcact tcattcaggg ggacctggag       660
     tgagtggagt gaccccgtca tctttcagac ccaggctggg gagcccgagg caggctggga       720
     ccctcacatg ctgctgctcc tggctgtctt gatcattgtc ctggttttca tgggtctgaa       780
     gatccacctg ccttggaggc tatggaaaaa gatatgggca ccagtgccca cccctgagag       840
     tttcttccag cccctgtaca gggagcacag cgggaacttc aagaaatggg ttaatacccc       900
     tttcacggcc tccagcatag agttggtgcc acagagttcc acaacaacat cagccttaca       960
     tctgtcattg tatccagcca aggagaagaa gttcccgggg ctgccgggtc tggaagagca      1020
     actggagtgt gatggaatgt ctgagcctgg tcactggtgc ataatcccct tggcagctgg      1080
     ccaagcggtc tcagcctaca gtgaggagag agaccggcca tatggtctgg tgtccattga      1140
     cacagtgact gtgggagatg cagagggcct gtgtgtctgg ccctgtagct gtgaggatga      1200
     tggctatcca gccatgaacc tggatgctgg ccgagagtct ggccctaatt cagaggatct      1260
     gctcttggtc acagaccctg cttttctgtc ttgcggctgt gtctcaggta gtggtctcag      1320
     gcttggaggc tccccaggca gcctactgga caggttgagg ctgtcatttg caaaggaagg      1380
     ggactggaca gcagacccaa cctggagaac tgggtcccca ggagggggct ctgagagtga      1440
     agcaggttcc ccccctggtc tggacatgga cacatttgac agtggctttg caggttcaga      1500
     ctgtggcagc cccgtggaga ctgatgaagg accccctcga agctatctcc gccagtgggt      1560
     ggtcaggacc cctccacctg tggacagtgg agcccagagc agctagcata taata           1615
//


spacer
spacer