spacer

EBI Dbfetch

ID   AF468028; SV 1; linear; mRNA; STD; MUS; 954 BP.
XX
AC   AF468028;
XX
DT   03-JUN-2002 (Rel. 72, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus lifeguard (Lfg) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-954
RA   Sole C., Segura M.F., Bayascas J.R., Comella J.X.;
RT   "Cloning and characterization of the long form of mouse lifeguard (LFG-L),
RT   an anti Fas-apoptotic molecule";
RL   Unpublished.
XX
RN   [2]
RP   1-954
RA   Comella J.X., Sole C., Segura M.F., Bayascas J.;
RT   ;
RL   Submitted (13-JAN-2002) to the INSDC.
RL   Ciencies Mediques Basiques, University of Lleida, Av. Rovira Roure, 44,
RL   Lleida E25198, Lleida
XX
DR   MD5; 74003afcfd2229035d2ca497cfebab5a.
DR   Ensembl-Gn; ENSMUSG00000023011; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023750; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..954
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /tissue_type="retina; eye"
FT                   /db_xref="taxon:10090"
FT   CDS             1..954
FT                   /codon_start=1
FT                   /gene="Lfg"
FT                   /product="lifeguard"
FT                   /note="LFG-L; anti-apoptotic; anti-Fas molecule; long form"
FT                   /db_xref="GOA:Q8K097"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="MGI:MGI:1919643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8K097"
FT                   /protein_id="AAM46781.1"
FT                   /translation="MTQGKLSVANKAPGTEGQQHQANGEKKDAPAVPSAPPSYEEATSG
FT                   EGLKAGTFPQGPTAVPLHPSWAYVDPSGSSGYEGGFPAGHHEHFTTFSWDDQKVRRLFI
FT                   RKVYTILLVQLLVTLAVVALFTFCDVVKDYVQANPGWYWASYAVFFATYLTLACCSGPR
FT                   RHFPWNLILLTIFTLSMAYLTGMLSSYYNTTSVLLCLVITALVCLSVTIFSFQTKFDFT
FT                   SCQGVLFVLLMTLFFSGLLLAVLLPFQYVPWLHAVYAVLGAGVFTLFLAFDTQLLMGNR
FT                   RHSLSPEEYIFGALNIYLDIIYIFTFFLQLYGTNRE"
XX
SQ   Sequence 954 BP; 173 A; 293 C; 242 G; 246 T; 0 other;
     atgacccagg gaaagctctc tgtggctaac aaggcccccg ggactgaggg gcagcagcac        60
     caggcaaatg gagagaagaa ggatgctccg gcagtgccct cggcgccacc ctcctatgag       120
     gaggccacct ctggagaggg gctgaaggca gggaccttcc cccagggccc aacagctgtg       180
     ccactccatc caagctgggc ctacgtggac cccagcggca gctccggcta tgaaggtggt       240
     ttccccgcag gacatcacga gcatttcacc accttcagct gggatgacca gaaagttcgt       300
     cggctcttca tcagaaaggt ctataccatc ctattggtcc agctgctggt gaccttggct       360
     gtggtggctc tctttacctt ctgtgatgtc gttaaggact atgtccaggc taaccccggc       420
     tggtactggg cgtcctatgc cgtgttcttt gcaacttacc tgactctggc ttgctgttct       480
     ggacccagga gacatttccc ttggaacctg attctgctga ccatctttac cctgtccatg       540
     gcctacctca ctgggatgct gtccagttac tacaacacga cgtctgtgct gctgtgcctg       600
     gtcatcacgg ctctcgtctg cctctcggtc accatcttca gtttccagac caagtttgac       660
     ttcacctcct gtcagggtgt gctgtttgtg ctgctcatga ccctcttctt cagtggactc       720
     ctcctcgctg tcctcctgcc cttccaatac gtcccctggc tccacgcggt ctatgctgta       780
     ctgggagcgg gtgtgttcac gttgttcctg gcctttgata cccagttgct gatgggtaac       840
     cgtcgacact cgctgagccc cgaggagtat atttttggag ccctcaacat ctacttagac       900
     attatctata tcttcacctt cttcctgcag ctgtatggca ccaaccggga atga             954
//


spacer
spacer