spacer

EBI Dbfetch

ID   AF458089; SV 1; linear; mRNA; STD; MUS; 3674 BP.
XX
AC   AF458089;
XX
DT   09-JAN-2002 (Rel. 70, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus adenylyl cyclase 3 (Adcy3) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3674
RA   Pasternak S., Neumann P.E.;
RT   "Sequence of mouse Adcy3";
RL   Unpublished.
XX
RN   [2]
RP   1-3674
RA   Pasternak S., Neumann P.E.;
RT   ;
RL   Submitted (12-DEC-2001) to the INSDC.
RL   Anatomy & Neurobiology, Dalhousie University, Sir Charles Tupper Medical
RL   Building, Halifax, NS B3H 4H7, Canada
XX
DR   MD5; c77402230f2b4b7c960a87fcbf4670ae.
DR   Ensembl-Gn; ENSMUSG00000020654; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020984; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000127756; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3674
FT                   /organism="Mus musculus"
FT                   /chromosome="12"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="3 week old"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:10090"
FT   CDS             146..3583
FT                   /codon_start=1
FT                   /gene="Adcy3"
FT                   /product="adenylyl cyclase 3"
FT                   /EC_number="4.6.1.1"
FT                   /note="adenylyl cyclase type III"
FT                   /db_xref="GOA:Q8VHH7"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR018297"
FT                   /db_xref="MGI:MGI:99675"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8VHH7"
FT                   /protein_id="AAL59384.1"
FT                   /translation="MPRNQGFSDPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGS
FT                   CLCLPRFMRLTFVPESLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVFSSDK
FT                   LAPLMVAGFGLVLDIILFVLCKKGLLPDRVSRKVVPYLLWLLISAQILSYLGLNFSRAH
FT                   AASDTVGWQAFFVFSFFITLPLSLSPIVIISVVSCVVHTLVLGVTVAQQQQDELEGMQL
FT                   LREILANVFLYLCAIIVGIMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLS
FT                   ILPKHVADEMLKDMKKDESQKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQEL
FT                   VKLLNELFARFDKLAAKYHQLRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAIS
FT                   YVREKTKTGVDMRVGVHTGTVLGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQ
FT                   STMDCLKGEFDVEPGDGGSRCDYLDEKGIETYLIIASKPEVKKTAQNGLNGSAVPNGAP
FT                   ASSKPSSPALIETKEPNGSAHASGSTSEEAEEQEAQADNPSFPNPRRRLRLQDLADRVV
FT                   DASEDEHELNQLLNEALLERESAQVVKKRNTFLLTMRFMDPEMETRYSVEKEKQSGAAF
FT                   SCSCVVLFCTAMVEILIDPWLMTNYVTFVVGEVLLLILTICSMAAIFPRSFPKKLVAFS
FT                   SWIDRTRWARNTWAMLAIFILVMANVVDMLSCLQYYMGPYNMTAGMELDGGCMENPKYY
FT                   NYVAVLSLIATIMLVQVSHMVKLTLMLLVTGAVTALNLYAWCPVFDEYDHKRFQEKDSP
FT                   MVALEKMQVLATPGLNGTDSMLLLVPSKYSMTVMMFVMMLSFYYFSRHVEKLARTLFLW
FT                   KIEVHDQKERVYEMRRWNEALVTNMLPEHVARHFLGSKKRDEELYSQSYDEIGVMFASL
FT                   PNFADFYTEESINNGGIECLRFLNEIISDFDSLLDNPKFRVITKIKTIGSTYMAASGVT
FT                   PDVNTNGFTSSSKEEKSDKERWQHLADLADFALAMKDTLTNINNQSFNNFMLRIGMNKG
FT                   GVLAGVIGARKPHYDIWGNTVNVASRMESTGVMGNIQVVEETQVILREYGFRFVRRGPI
FT                   FVKGKGELLTFFLKGRDRPAAFPNGSSVTLPHQVVDNP"
XX
SQ   Sequence 3674 BP; 813 A; 1034 C; 1021 G; 806 T; 0 other;
     cccactaagc attccagctc cagttggacg cccttcattc ataaccaaga ggaacctccc        60
     cgccttcccc gggtcttacg aagccctggt gaagtggctt gacctgcagg tctcccttcc       120
     tcattagaaa cagccagcag ccaacatgcc gaggaaccag ggcttctcgg atcccgagta       180
     ctcggcagag tactcagctg aatactcggt cagcctgccc tctgaccccg accgcggggt       240
     cggccggacc catgaaattt ctgtgcggaa ctcggggtcc tgcctgtgcc tgcctcgctt       300
     tatgcggctg accttcgtgc ctgagtcctt ggagaacctc taccagacct acttcaaaag       360
     gcagcgccat gagaccctgc tggtgctggt ggtctttgcg gccctctttg actgctacgt       420
     ggtagtgatg tgcgcggtgg tcttctccag cgacaagctg gcgcccctca tggtggcagg       480
     cttcggtctg gtgttggaca tcatcctttt cgtgctctgt aaaaaggggc tgctcccgga       540
     ccgagtgagc cgcaaagtgg taccctacct gctgtggctg ctcatctcgg cccagatctt       600
     gtcctacctg ggcctgaact tttcacgggc ccacgcagcc agtgacactg tgggttggca       660
     ggctttcttt gtcttctcct tcttcataac gctgcccctc agcctcagcc ccatcgtgat       720
     catctctgtg gtctcctgtg ttgtgcacac gcttgtgttg ggggtcactg tggcccagca       780
     gcagcaggat gagctggaag ggatgcagct gctgagggag atcctggcca acgtcttcct       840
     ctacctgtgt gctatcatcg tgggcatcat gtcctactac atggcagacc gcaagcaccg       900
     caaggccttc ctggaggccc gccagtcact ggaggtgaag atgaatctgg aggagcagag       960
     ccagcagcag gaaaacctta tgctttccat cctgcccaag cacgtggctg acgagatgct      1020
     gaaggacatg aagaaggacg agagccagaa ggaccagcag cagttcaata ccatgtacat      1080
     gtaccggcac gagaatgtca gcatcctgtt tgcagatatt gtgggcttta cccagctgtc      1140
     ctctgcttgc agtgcccagg agctcgtgaa gttactcaac gagctcttcg cccgctttga      1200
     caagctggca gccaaatacc accagctgag gatcaagatc ctaggcgact gttactactg      1260
     catctgcggc ttgcctgact accgggagga ccatgccgtg tgctccatcc ttatggggct      1320
     tgccatggta gaggccatct cgtacgtgcg ggagaagacc aagactggag tggacatgcg      1380
     tgtgggagtg cacacaggca ctgtcctagg cggtgtcctg ggccagaagc gctggcagta      1440
     tgatgtatgg tctactgatg tcaccgtggc aaacaagatg gaggctggtg gcatcccagg      1500
     gcgcgtgcac atttcccaga gcaccatgga ctgcctgaag ggggagtttg atgtggagcc      1560
     tggtgatggg ggcagtcgct gcgactacct agatgagaag ggcatcgaaa cctacctcat      1620
     cattgcctcc aagccagagg tgaagaaaac agcccaaaat ggcctcaacg gctcggccgt      1680
     gccaaacgga gcgccggcat cctccaaacc cagctcccct gccctcatcg agaccaagga      1740
     gcccaatgga agtgcccatg ccagcggctc cacatcagag gaggctgaag aacaggaggc      1800
     ccaggctgac aacccctcgt tccccaaccc ccgccgcagg ctgcgcctcc aggacctggc      1860
     ggaccgtgtg gtggacgcct ctgaggatga gcacgaactg aaccagctgc ttaatgaggc      1920
     cctgctggag cgggagtccg cccaggtggt aaagaagaga aacacattcc tcctgaccat      1980
     gaggttcatg gacccagaga tggaaacacg ctactcggtg gagaaggaga agcagagcgg      2040
     ggctgccttc agctgctcct gtgtggtcct cttctgcacg gccatggtgg agatactcat      2100
     tgacccctgg ctgatgacaa actatgtgac ctttgtggtt ggggaggttc tgctcctgat      2160
     cctgaccatc tgctcgatgg ctgccatctt tcccaggtca tttcccaaga agcttgtggc      2220
     cttctcatct tggattgacc ggacccgctg ggcaaggaac acctgggcca tgttagccat      2280
     cttcattctg gttatggcca atgttgtgga catgctcagc tgtctccagt actacatggg      2340
     accttacaac atgacagctg ggatggagct ggacggcggc tgcatggaga accccaagta      2400
     ctacaactac gtagctgtgc tgtcgctcat cgccaccatc atgctggtgc aggtcagcca      2460
     catggtgaag ctgacgctca tgctgctcgt cacaggcgcc gtgactgccc tcaacctgta      2520
     cgcctggtgt cctgtctttg atgaatacga ccacaagcgc tttcaggaaa aggactctcc      2580
     tatggtggcc ttagagaaga tgcaggtact tgccacccct gggctcaatg gcactgacag      2640
     catgctgctc ctggtgcctt ccaagtactc catgactgtg atgatgttcg tcatgatgct      2700
     gagcttttac tacttctcgc gccacgtgga aaaactggcc cgaacactgt tcttgtggaa      2760
     gattgaggtc catgaccaga aagaacgtgt ctacgagatg cgccgatgga acgaggcctt      2820
     ggtcaccaac atgttgcctg agcatgttgc acgccatttt ctggggtcca agaagagaga      2880
     tgaggagctg tacagccagt cttatgacga gattggagtc atgtttgcct ccttgcccaa      2940
     ctttgctgac ttctacactg aggagagcat caacaacggc ggcatcgagt gtctacgctt      3000
     cctcaatgag atcatctctg attttgactc tctcctggac aatcccaaat tccgggtcat      3060
     caccaagatc aaaactattg gcagcaccta tatggcagct tcaggagtca caccagatgt      3120
     caacaccaat ggctttacaa gctccagcaa ggaggagaag tcagacaagg agcgctggca      3180
     gcacctggct gacctggctg actttgcatt agccatgaag gacacgctca caaacatcaa      3240
     caaccagtca ttcaacaact tcatgttgcg cataggcatg aacaaaggag gggttctggc      3300
     tggcgtcatt ggagcccgga aaccacacta tgacatctgg ggcaatacgg tcaatgtggc      3360
     cagcaggatg gaatccacag gagtcatggg caacatccag gtggtagaag agacgcaggt      3420
     catccttcga gagtacggct tccgctttgt gaggcgaggt cccatctttg tgaaaggcaa      3480
     aggggagctt ctgacctttt tcttgaaggg gcgggacagg ccagctgcct tccccaatgg      3540
     ctcctctgtt acactgcccc accaagtggt ggacaacccc tgagcgacct ctggctccac      3600
     agtggtccac ataggaaggg ggattttttt ggaagcagtg aaaagctttg ggaaaggaca      3660
     aatgaccaag tcct                                                        3674
//


spacer
spacer