spacer

EBI Dbfetch

ID   AF455270; SV 1; linear; mRNA; STD; MUS; 1322 BP.
XX
AC   AF455270;
XX
DT   22-JAN-2002 (Rel. 70, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus C21ORF80 (C21orf80) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1322
RA   Menzel O., Reymond A., Antonarakis S.E., Guipponi M.;
RT   "C21orf80, a new gene from the 21q22.3 region: using RNAi to get insight
RT   into the function";
RL   Unpublished.
XX
RN   [2]
RP   1-1322
RA   Menzel O., Reymond A., Antonarakis S.E., Guipponi M.;
RT   ;
RL   Submitted (05-DEC-2001) to the INSDC.
RL   Division of Medical Genetics, University of Geneva Medical School, CMU, 1,
RL   rue Michel Servet, Geneva, GE 1211, Switzerland
XX
DR   MD5; 7eb8311bb4504708679256b4e0f4d6bf.
DR   Ensembl-Gn; ENSMUSG00000020260; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020493; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1322
FT                   /organism="Mus musculus"
FT                   /chromosome="10"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             14..1303
FT                   /codon_start=1
FT                   /gene="C21orf80"
FT                   /product="C21ORF80"
FT                   /db_xref="GOA:Q8VHI3"
FT                   /db_xref="InterPro:IPR019378"
FT                   /db_xref="MGI:MGI:1916863"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8VHI3"
FT                   /protein_id="AAL65192.1"
FT                   /translation="MAALSVVCLLLAAASWRPVSASGEEFWPGQSAADILSGAASRRRY
FT                   LLYDVNPPEGFNLRRDVYIRVASLLKTLLKTEEWVLVLPPWGRLYHWQSPDIHQVRIPW
FT                   SEFFDLPSLNKNIPVIEYEQFIAESGGPFIDQVYVLQGYAEGWKEGTWEEKVDARPCID
FT                   PLLYSQDKHEYYRGWFWGYEETRGLNVSCLSVQGSASIVAPVLLKNTSARSVMLDRAEN
FT                   LLHDHYGGREYWDTRRSMVFAKHLRAVGDEFRSQHLNSTDAADKMAPEEDWTKMKVKLG
FT                   SALGGPYLGVHLRRKDFIWGHREDVPSLEGAVKKIRSLMKTHQLDKVFVATDAIRKEQE
FT                   ELRKLLPEMVRFEPTWEELELYKDGGVAIIDQWICAHARFFIGTSVSTFSFRIHEEREI
FT                   LGLDPKTTYNRFCGDQEKACEQPTHWKIAY"
XX
SQ   Sequence 1322 BP; 286 A; 356 C; 414 G; 266 T; 0 other;
     ggccgccggg gccatggcgg cgctcagcgt cgtctgcctg ctgctggcag cggcatcctg        60
     gcggccggtc tcggcttcag gagaagaatt ctggcctggc cagtcggcgg cggacatcct       120
     gtcgggggcg gcatcccgca gacggtacct cctgtatgat gtcaaccccc cagaaggctt       180
     caatctccgc agggatgtct atatccgggt ggcatccttg ctgaagacgc tgttgaagac       240
     tgaagagtgg gtgctagtcc tgcccccgtg gggccgcctc taccactggc aaagccctga       300
     catccaccag gtccggattc cctggtccga gttttttgac ctcccgagtc tcaataaaaa       360
     catccccgtt atagagtatg agcagttcat tgcagagtcc ggcgggccct ttatcgacca       420
     ggtgtacgtc ctacaaggtt acgccgaggg ctggaaggag ggcacctggg aggagaaggt       480
     ggacgcacgg ccctgtattg accctctgct gtactcgcag gacaagcatg agtattacag       540
     aggctggttt tggggctacg aagaaacacg gggtctgaat gtctcctgcc tgtccgtcca       600
     ggggtcggct tccatcgtcg cgcctgtcct cttaaaaaac acatctgctc ggtctgtgat       660
     gctggaccga gctgagaatc tgcttcatga ccactatgga ggccgggagt actgggatac       720
     ccggcgcagc atggtgtttg caaagcactt gcgggctgtg ggagacgagt ttaggagcca       780
     gcacctcaac tcgacggatg ccgctgataa gatggccccg gaggaagact ggacgaagat       840
     gaaggtcaaa ctgggctcag cactaggcgg cccctacctc ggagtccacc tgagaaggaa       900
     ggacttcatc tggggccaca gggaggatgt gcccagcctg gagggcgccg tgaagaagat       960
     ccgcagcctc atgaagactc atcagctgga caaggtgttc gtggccacag acgccatcag      1020
     gaaggagcag gaagaattga ggaagctgct gccggaaatg gtgaggtttg agcccacgtg      1080
     ggaggagctg gagctgtaca aggacggagg cgtcgccatc atcgatcagt ggatctgcgc      1140
     tcatgccagg ttttttattg gcacctctgt ttccacattt tcctttcgga ttcatgaaga      1200
     gagagagatc ctggggttgg accccaagac aacatacaac cggttttgtg gagaccagga      1260
     gaaagcatgt gagcagccca cacactggaa gattgcgtac tgagggccac ctatccaccg      1320
     cc                                                                     1322
//


spacer
spacer