spacer

EBI Dbfetch

ID   AF455140; SV 1; linear; genomic DNA; STD; MUS; 5178 BP.
XX
AC   AF455140;
XX
DT   25-JUN-2002 (Rel. 72, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 3)
XX
DE   Mus musculus Src homology 2 domain-containing transforming protein 1
DE   isoform p66 and Src homology 2 domain-containing transforming protein 1
DE   isoform p52 genes, alternative promoter regions, exons 1 and 2 and partial
DE   cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-5178
RX   DOI; 10.1074/jbc.M200280200.
RX   PUBMED; 11948181.
RA   Ventura A., Luzi L., Pacini S., Baldari C.T., Pelicci P.G.;
RT   "The p66Shc longevity gene is silenced through epigenetic modifications of
RT   an alternative promoter";
RL   J Biol Chem 277(25):22370-22376(2002).
XX
RN   [2]
RP   1-5178
RA   Ventura A., Luzi L.;
RT   ;
RL   Submitted (05-DEC-2001) to the INSDC.
RL   Dpt. Experimental Oncology, European Institute of Oncology, Via Ripamonti
RL   435, Milano 20141, Italy
XX
DR   MD5; 47fd244b6e5a41cc009af4c684294cba.
DR   Ensembl-Gn; ENSMUSG00000042626; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000039110; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000094378; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107417; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5178
FT                   /organism="Mus musculus"
FT                   /strain="129/SvJ"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   promoter        536..776
FT                   /note="p52SHC alternative promoter"
FT   exon            777..898
FT                   /number=1
FT   promoter        3640..3844
FT                   /note="p66SHC alternative promoter"
FT   exon            3845..4534
FT                   /number=2
FT   mRNA            <4040..>4534
FT                   /product="Src homology 2 domain-containing transforming
FT                   protein 1 isoform p66"
FT   CDS             4040..>4534
FT                   /codon_start=1
FT                   /product="Src homology 2 domain-containing transforming
FT                   protein 1 isoform p66"
FT                   /note="p66SHC"
FT                   /db_xref="GOA:P98083"
FT                   /db_xref="InterPro:IPR000980"
FT                   /db_xref="InterPro:IPR006019"
FT                   /db_xref="InterPro:IPR006020"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="MGI:MGI:98296"
FT                   /db_xref="UniProtKB/Swiss-Prot:P98083"
FT                   /protein_id="AAM61857.1"
FT                   /translation="MDLLPPKPKYNPLRNESLSSLEEGASGSTPPEELPSPSASSLGPI
FT                   LPPLPGDDSPTTLCSFFPRMSNLKLANPAGGRLGPKGEPGKAAEDGEGSAGAALRDSGL
FT                   LPLLQDMNKLSGGGGRRTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYL
FT                   VR"
FT   mRNA            <4370..>4534
FT                   /product="Src homology 2 domain-containing transforming
FT                   protein 1 isoform p52"
FT   CDS             4370..>4534
FT                   /codon_start=1
FT                   /product="Src homology 2 domain-containing transforming
FT                   protein 1 isoform p52"
FT                   /note="p52SHC"
FT                   /db_xref="GOA:P98083"
FT                   /db_xref="InterPro:IPR000980"
FT                   /db_xref="InterPro:IPR006019"
FT                   /db_xref="InterPro:IPR006020"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="MGI:MGI:98296"
FT                   /db_xref="UniProtKB/Swiss-Prot:P98083"
FT                   /protein_id="AAM61858.1"
FT                   /translation="MNKLSGGGGRRTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKV
FT                   MGPGVSYLVR"
XX
SQ   Sequence 5178 BP; 998 A; 1484 C; 1258 G; 1437 T; 1 other;
     gtttaaaaag caactgtcac taggctgcac tggggggnaa ttaaagaccc gctttagtga        60
     tgtgaattcc catatgtaaa actgatcaga gctacaagac gcttcaattt aacagccggc       120
     caactctaag ttccctttca ttgttttaca tcctccgtcc accttttgcg catgtgcttt       180
     gctgctgtac ccaatcccac ccccacccca ctccccggta attccttgcg cacgcgcccg       240
     ttctacactg tcccccgccc ccatcccccg cctcccactc cggcctaggt aactaactcc       300
     tcgcgtgctc tcttttgtct gtagtccccg cgccggcact aaccggtatt cgaactcctc       360
     gtcgtcgtat ttgtccgaat agtagatttg tttgtgggac atgattgctc tgtccgaggg       420
     cgctcagccc cgcgccgcag gcctccagac aactcccagc agcacgcgct cccaccctct       480
     ttggcctcgc tttcaaacac accgcccgca cttcctattg gtctctgcgg ccgaaggcgg       540
     gacagctcca ttttgaagtc ctcgattggc ttgctttggc gtctcttcaa gtcgtaaatg       600
     gagtgctgtg ctcaggtttc tgaagaatga gctgggtcaa actaggattc tcattggctc       660
     tcactgcgcc ccttgagcct gctggcgcag ccattggcca actttggaaa gcagacgggt       720
     aaaggaggga cagcgaggta gggggtcagg ggttagtgag gccggaagtg agtgtaataa       780
     agtttgtctg gggaggccca ggctggggtg aaagttgggg cggtgactta agcagacagt       840
     tgcgtgatcc ggaaccagat cggcccgcgg tgcggtgcgg agactccatg agaccctggt       900
     aagtctagac tttctttctg tggcgaccaa ctcctcttcc accccggaac ccctctccca       960
     ggaccctact tccggtcttg ctgtataagt cccgcccccg agacccctct ccggaagtcc      1020
     caccttccta cttcaagggg ctccctgaac cccgacttgt ctcttatgat cgcgaccaca      1080
     ccctgtggtc ttactttcct gggaatcgca cccccagacg tgtttcccag caccatatga      1140
     ttagtcttcc ttgttctctc tctgagtctg cctcttcagg attctcggtt gaacccagtc      1200
     tatccattgc ctggcttcca aaagagggaa aaccgtgctt ttgaaagacc gatgtgactt      1260
     tgtagaagtg acgcctcttt gggaccccgc ccctttggga cccgcccctt ccactgtcca      1320
     cgtccgatcc tgggaatgtg ccgtactccc tgtttaggga ccttgtcccc tcaggattct      1380
     ccttcctctt gggcttgggt cagtgccgca aaacccaggt cttaaatgcc tgacgtttca      1440
     tccgcttcta tatccctctc cttgttttaa gctttgggct taattctcct gagctctggt      1500
     gctccataag gtggggggtt gaaatttgtg gttgtaagga gtgagcttat tagcagcgtc      1560
     gcccctctcc cctcttcgcc cacccccgta accttcgaga gtgaattaag tcgaagggac      1620
     tgaatttcgt ttacagctgg agagtggatg aaggaaagga gactcttgac tcctttgaga      1680
     ccccatccca aagacagcca tagatggcac cttcccatgc ctggattgga ctaagcattg      1740
     gtttgtgtga gcctaacggg agtcaaagtt ttcctgctgt caaaagaaaa actgttttgg      1800
     agacaggagt agaggttctc gtcctttccg ctgtttttac aagacccctc cccctatcca      1860
     gatattctag tttggcattc atcctggccc cacttgccta accttccctg ctggaaacat      1920
     tcctgaggct ttcgccattt cctgctattt cctgcccctc cagcttcctc cctgctgtgc      1980
     cgaggtgttt aacgcggctt ttctcctgcc cttactacct agccttgggt gcaggaggca      2040
     atctctaagc aaacttaaag gctcgtgttg actttttctt ccaaatgcgg gcacctcttg      2100
     ctcatccctg gccttccgat atgaaagctc ccaggaagag ccatctctca agatgacacc      2160
     atggtgtgtt tgtgtgattg ggagtgtaag agctgaggtc ttagcaaaca gaatgacaga      2220
     atttcttttc aggaagagat gtggtattca gtaacagctt tcctgggatg gggactaagc      2280
     acaggggaga gaatgaaggg tggtatttaa actgctttaa gtgctgctga agaggtctga      2340
     aggtagacac tttgagcaac ctccgcagcc acagcagcgg ttaggcaagt ggaggcaaac      2400
     cccggtgatt ggttctctgt aagttccagg ccatcctggt cagcctggtc tacaaagcaa      2460
     gttccagggc agtcagtgtt gttacataga caaaccctat cttgaaaaaa caaataagca      2520
     aaaagtatct tttatttctt gtatttggtt tttttttttt tttttttttg gttttcgaga      2580
     cagggtttct ctgtatagcc ctggctgtcc tggaactcac tttgtagacc aggctggcct      2640
     cgaactcaga aatccacctg cctctgctgg gattaaaagg gtgcaccacc acacccagct      2700
     actttttttt tttttttttt aagggaataa agcgatagtt tattctggag ctattttgat      2760
     tggtcacttt ctttaagttc ctgaatggcc ttaagcagag ctgtggcagg aaactgtggg      2820
     caaagaaata tgggtttggt attattatgc acttatggcc agactccaac ttctaatatc      2880
     cctttctcct tcctgtcttt attaacacag atttgtttat gaccctatta tccctttgtg      2940
     gcttgtaggc accagttctg tttctttccc ctacctccaa ggccaactcc tccactagcc      3000
     tgaggtacac tgtcaggtgg tttactgcct gtaaggagta acaatatatc tgtaggtccg      3060
     aggggtggct gcatgtctct gtaccctctg gggaagccct actcccaccc cccaagtctg      3120
     ttggtccttg gtgacttgta gaaacaggct tgctctagct cttgtctggt agccccctga      3180
     tgtaccacca ataaattggc ctttattccc attttagctt gtctttcctc ttggctttgc      3240
     actatatcca ctgggactta ctttctctcc ctggttctct actgtggtcc acagctgttg      3300
     tggtggagga tgctaatggc ccaggttccc tggagctacc acctcactca ctgtatggtg      3360
     gggatgggag tggtctgggc tgtctgggct agggggctag tcacgtcttc agccaggact      3420
     ggaaaggaaa tgctaaactc tgggggacat ctcccccctt cccctccccg cccagcagct      3480
     tctgtttcct ctctatccct tcctgtcttc ctgctctctt tggcttgccc acgtcggttt      3540
     ggattggtcc agagtttctc ttaactcctt cctttctttt ttctcttttg cttatttttc      3600
     catctttttt tcgcgccggg cacctcctcc ttcccagaca gttgtttgta ttgggctggg      3660
     agagtggcct ggcttgcaca aattgtgtgg ggaggtgtct cagcccctct gagcctgtga      3720
     gtcagcactg tcctggggat tggtctctct ccttagttcc ccgcctctgg ggaggagcca      3780
     gtaagctctg ggtccagcct gtactcctca gccagtagag gtttcctagc tgggctgtgc      3840
     aaggatgtgc tctcaaactg tctaggtctg agttgggaga gcagaggtca cttgtccttc      3900
     gcctccccag gtcatctgtt atcaccgggc tgccgaggtc agactaggct aagggcctgg      3960
     ggatgccccc tgcctggccc ccttgcctga attggcaggg gggccgggct gggcagcagc      4020
     ccctcttctc accccagcca tggatcttct accccccaag ccgaagtaca acccacttcg      4080
     gaatgagtct ctgtcatcgc tggaggaggg ggcttcgggg tctacccctc cggaggagct      4140
     accttcccca tcagcttcat ccctgggacc cattctgcct cctctgccgg gggacgatag      4200
     tccgactacc ctgtgttcct tctttccccg gatgagcaac ctgaagctgg ccaatcctgc      4260
     tggggggcgc ctggggccta aaggggagcc aggaaaggct gctgaagatg gggaagggag      4320
     tgcaggggca gcccttcggg actcaggcct cttgcccctc ctccaggaca tgaacaagct      4380
     gagtggaggc ggcgggcgca ggactcgggt agaagggggc cagctggggg gcgaggagtg      4440
     gaccagacac gggagctttg tcaataagcc cacacgaggc tggctgcatc ccaacgacaa      4500
     agtcatggga cctggggttt cctacttggt tcgggtgagt gcataccccc ctcccactcc      4560
     ctcccgtcca gttcctctgc tcactccaga tttgccaggg actccctgct cttcccccag      4620
     caacatctgt gccattctct cagttcttag acctggtgca ttccttcttc aggtctctgc      4680
     ccttaattta gcctgtgaat cttctgcctt tcctcctttg gtcccacccc ccccccccac      4740
     ccccccagtt cacacagtgc ccaagcacat ctgaggcttt ctgtaaaagt tgaatgaaaa      4800
     tgacttcttg attattccct ctagactcct cccttttcca gagatgtcac tccatcccac      4860
     tcaatgtttg ctactcctct cgcagtcccc ccatggtgca cgaagttcct cttttgtggt      4920
     ctttcttccc tttttcccct ttgccataca cctatgaagt ggaagcccca ggcagtagga      4980
     aggctacttc aatctacttt ccttaggaag taaggactat ataaggcaaa gccctagaac      5040
     cttctgcaaa gggcttgcaa gtgtggggtg ggggaattgg ggtcagctga tccattcttt      5100
     ccttcttccc ctacagtaca tggggctgtg cgggaggtct tacagtcaat gcgagccctt      5160
     gacttcaata cccagaca                                                    5178
//


spacer
spacer