Dbfetch

ID   AF449483; SV 1; linear; mRNA; STD; MUS; 353 BP.
XX
AC   AF449483;
XX
DT   29-JAN-2002 (Rel. 70, Created)
DT   29-JAN-2002 (Rel. 70, Last updated, Version 1)
XX
DE   Mus musculus aggrecanase-1 mRNA, partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-353
RA   Daikou S., Glaeser K.E., Horner A., Davies E.M., Jeffcott L.B.;
RT   "Expression of murine aggrecanases";
RL   Unpublished.
XX
RN   [2]
RP   1-353
RA   Daikou S., Glaeser K.E., Horner A., Davies E.M., Jeffcott L.B.;
RT   ;
RL   Submitted (20-NOV-2001) to the INSDC.
RL   Department of Clinical Veterinary Medicine, University of Cambridge,
RL   Madingley Road, Cambridge, Cambs CB3 0ES, UK
XX
DR   MD5; 3c58701e694df8749bf5d0840d15a714.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..353
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /cell_line="ATDC5"
FT                   /cell_type="chondrogenic EC"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..>353
FT                   /codon_start=1
FT                   /product="aggrecanase-1"
FT                   /db_xref="GOA:Q8VHK4"
FT                   /db_xref="InterPro:IPR001590"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="MGI:MGI:1339949"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VHK4"
FT                   /protein_id="AAL68774.1"
FT                   /translation="HVFNMLHDNSKPCTNLNGQGGSSRHVMAPVMAHVDPEEPWSPCSA
FT                   RFITDFLDNGYGHCLLDKPEAPLHLPATFPGKDYDADRQCQLTFGPDSSHCPQLPPPCA
FT                   ALWCSGHLNGHAM"
XX
SQ   Sequence 353 BP; 68 A; 120 C; 82 G; 83 T; 0 other;
     catgtcttca acatgctcca tgataactcc aagccatgca ctaacttgaa tgggcagggg        60
     ggttcctctc gccatgtcat ggctcctgtc atggcccatg tggaccctga agagccctgg       120
     tcgccctgca gtgcccgatt catcactgac ttcctggaca atggttatgg gcactgcctc       180
     ttagacaaac cggaggctcc cctccatcta ccagcgactt ttcctggcaa ggactatgac       240
     gctgaccgcc aatgccaact gaccttcggt cctgactcaa gccattgtcc acagctgcca       300
     ccgccctgtg ctgccctctg gtgctctggc cacctcaatg gccatgccat gtg              353
//