spacer

EBI Dbfetch

ID   AF441789; SV 1; linear; genomic DNA; STD; HUM; 423 BP.
XX
AC   AF441789;
XX
DT   30-NOV-2001 (Rel. 69, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*new allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-423
RX   DOI; 10.1111/j.0001-2815.2004.00275.x.
RX   PUBMED; 15304015.
RA   Chu C.C., Lee H.L., Hsieh N.K., Trejaut J., Lin M.;
RT   "Two novel HLA-DRB1 alleles identified using a sequence-based typing:
RT   HLA-DRB1*1443 and HLA-DRB1*1351*";
RL   Tissue Antigens 64(3):308-310(2004).
XX
RN   [2]
RP   1-423
RA   Hsieh N.-K., Chu C.-C., Lin M.;
RT   "A new HLA-DRB1 variant found in leprosy patient";
RL   Unpublished.
XX
RN   [3]
RP   1-423
RA   Hsieh N.-K., Chu C.-C., Lin M.;
RT   ;
RL   Submitted (01-NOV-2001) to the INSDC.
RL   Medical Research Department, Macky Memorial Hospital, Taipei, Taiwan
XX
DR   MD5; 51dcece439e23d0c0fe51293ef5f627d.
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
DR   Ensembl-Tr; ENST00000415796; homo_sapiens.
DR   Ensembl-Tr; ENST00000428566; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..423
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>423
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*new"
FT   mRNA            <115..>384
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*new"
FT                   /product="MHC class II antigen"
FT   CDS             <115..>384
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*new"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q5Y7A7"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*13:51"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5Y7A7"
FT                   /protein_id="AAL35834.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFHNQEENVRFDSDVGEFRAL
FT                   TELGRPDAEYWNSQKDILEDERAAVDTYCRHNYGVVESFTVQRR"
FT   exon            115..384
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*new"
FT                   /number=2
XX
SQ   Sequence 423 BP; 76 A; 115 C; 153 G; 79 T; 0 other;
     ccggttaagg ttcccagtgc ccgcacccgg cccagggagc cccggatggc ggcgtcactg        60
     tcagtgtctt ctcaggaggc cgcctgtgtg actggatcgt tcgtgtcccc acagcacgtt       120
     tcttggagta ctctacgtct gagtgtcatt tcttcaatgg gacggagcgg gtgcggttcc       180
     tggacagata cttccataac caggaggaga acgtgcgctt cgacagcgac gtgggggagt       240
     tccgggcgtt gacggagctg gggcggcctg atgccgagta ctggaacagc cagaaggaca       300
     tcctggaaga cgagcgggcc gcggtggaca cctactgcag acacaactac ggggttgtgg       360
     agagcttcac agtgcagcgg cgaggtgagc gcggcgcggg gcggggcctg agtccctgtg       420
     agc                                                                     423
//


spacer
spacer