Dbfetch

ID   AF440692; SV 1; linear; mRNA; STD; MUS; 2094 BP.
XX
AC   AF440692;
XX
DT   22-NOV-2001 (Rel. 69, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus transferrin mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2094
RA   Lai D.-Z.;
RT   "Construction of a robust CHO cell-line for biopharmaceutical production";
RL   Unpublished.
XX
RN   [2]
RP   1-2094
RA   Lai D.-Z., Chen W., Wang H.T.;
RT   ;
RL   Submitted (30-OCT-2001) to the INSDC.
RL   Department of Applied Molecular Biology, Beijing Institute of Microbiology
RL   and Epidemiology, 20 Dongdajie, Beijing, Beijing 100071, China
XX
DR   MD5; 71c5a63b2cdffe47662a197e51d6aef1.
DR   Ensembl-Gn; ENSMUSG00000032554; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035196; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0035176; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0035108; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035169; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034879; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035689; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034191; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0034848; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0035009; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0034957; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0035085; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034996; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035711; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034311; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000035158; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112645; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0093929; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0094013; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0093966; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0093939; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0093516; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0094453; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0094114; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0093435; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0093645; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0093499; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0093653; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0093475; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0094780; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0092513; mus_musculus_wsbeij.
DR   EuropePMC; PMC1513230; 16674826.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2094
FT                   /organism="Mus musculus"
FT                   /strain="BALB/c"
FT                   /mol_type="mRNA"
FT                   /tissue_type="liver"
FT                   /db_xref="taxon:10090"
FT   CDS             1..2094
FT                   /codon_start=1
FT                   /product="transferrin"
FT                   /db_xref="GOA:Q921I1"
FT                   /db_xref="InterPro:IPR001156"
FT                   /db_xref="InterPro:IPR016357"
FT                   /db_xref="InterPro:IPR018195"
FT                   /db_xref="InterPro:IPR030685"
FT                   /db_xref="MGI:MGI:98821"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q921I1"
FT                   /protein_id="AAL34533.1"
FT                   /translation="MRFAVGALLACAALGLCLAVPDKTVKWCAVSEHENTKCISFRDHM
FT                   KTVLPPDGPRLACVKKTSYPDCIKAISASEADAMTLDGGWVYDAGLTPNNLKPVAAEFY
FT                   GSVEHPQTYYYAVAVVKKGTDFQLNQLEGKKSCHTGLGRSAGWVIPIGLLFCKLSEPRS
FT                   PLEKAVSSFFSGSCVPCADPVAFPKLCQLCPGCGCSSTQPFFGYVGAFKCLKDGGGDVA
FT                   FVKHTTIFEVLPEKADRDQYELLCLDNTRKPVDQYEDCYLARIPSHAVVARKNNGKEDL
FT                   IWEILKVAQEHFGKGKSKDFQLFSSPLGKDLLFKDSAFGLLRVPPRMDYRLYLGHNYVT
FT                   AIRNQQEGVCPEGSIDNSPVKWCALSHLERTKCDEWSIISEGKIECESAETTEDCIEKI
FT                   VNGEADAMTLDGGHAYIAGQCGLVPVMAEYYESSNCAIPSQQGIFPKGYYAVAVVKASD
FT                   TSITWNNLKGKKSCHTGVDRTAGWNIPMGMLYNRINHCKFDEFFSQGCAPGYEKNSTLC
FT                   DLCIGPLKCAPNNKEEYNGYTGAFRCLVEKGDVAFVKHQTVLDNTEGKNPAEWAKNLKQ
FT                   EDFELLCPDGTRKPVKDFASCHLAQAPNHVVVSRKEKAARVKAVLTSQETLFGGSDCTG
FT                   NFCLFKSTTKDLLFRDDTKCFVKLPEGTTPEKYLGAEYMQSVGNMRKCSTSRLLEACTF
FT                   HKS"
XX
SQ   Sequence 2094 BP; 529 A; 518 C; 571 G; 476 T; 0 other;
     atgaggttcg ctgtgggtgc cctgctggct tgtgccgccc tggggctgtg tctggctgtc        60
     cctgacaaaa cggtcaaatg gtgcgcagtg tcagagcacg agaataccaa atgcatcagc       120
     ttccgtgacc acatgaagac cgtccttccg cctgatggcc cccgacttgc ctgtgtgaag       180
     aaaacctcct atccggattg catcaaggcc atttctgcaa gtgaagccga tgctatgacc       240
     ttggatgggg gttgggtgta cgatgccggc ctgactccga acaacctgaa gcccgtggcg       300
     gcggagtttt atggatcagt ggaacatcca cagacctact actacgctgt ggctgtggta       360
     aagaagggaa cagacttcca gctgaaccag ctcgaaggca agaagtcctg ccacacaggc       420
     ctgggaaggt ctgcaggctg ggtcatcccc attggcttgc tcttctgtaa gctgtcggag       480
     ccccgcagtc ctcttgagaa agctgtgtcc agtttcttct cgggcagttg tgtcccctgt       540
     gcagatccag tggccttccc caaactgtgt caactgtgcc caggctgtgg ctgctcctcc       600
     actcaaccgt tctttggcta cgtaggcgca ttcaagtgtc tgaaagatgg cggtggggat       660
     gtggcctttg tcaagcacac aaccatattt gaggtcttgc cggagaaggc tgacagggac       720
     caatatgaac tgctctgcct tgacaatacc cgcaagccag tggatcagta tgaggattgc       780
     tacctggctc ggatcccttc tcatgctgtt gtggctcgaa aaaacaatgg caaggaagac       840
     ttgatctggg agattctcaa agtggcacag gaacactttg gcaaaggcaa atcaaaagac       900
     ttccaactgt tcagctctcc tcttgggaaa gacctgctgt ttaaagattc tgcctttggg       960
     ctgttaaggg tccccccaag gatggactac aggctgtacc ttggccataa ctatgtcact      1020
     gccattcgga atcagcagga aggcgtgtgc ccggagggct cgatcgacaa ctcgccagtg      1080
     aagtggtgtg cactgagtca cctggagaga accaagtgtg acgagtggag catcatcagt      1140
     gagggaaaga tagagtgtga gtcagcagag accactgagg actgcattga aaagattgtg      1200
     aacggagaag cggacgccat gactttggat ggaggacatg cctacattgc aggccagtgt      1260
     ggtctagtgc ctgtcatggc agagtactac gagagctcta attgtgccat cccatcacaa      1320
     caaggtatct ttcctaaagg gtattatgcc gtggctgtgg tgaaggcatc ggacactagc      1380
     atcacctgga acaacctgaa aggcaagaag tcctgccaca ctggggtaga cagaaccgct      1440
     ggttggaaca tccctatggg catgctgtac aacaggatca accactgcaa attcgatgaa      1500
     tttttcagtc aaggctgcgc tcccgggtat gagaagaatt ccaccctctg tgacctgtgt      1560
     attggcccac tcaaatgtgc tccgaacaac aaagaggaat ataatggtta cacaggggct      1620
     ttcaggtgtc tcgttgagaa aggagatgta gcctttgtga aacaccagac tgtcctggat      1680
     aacaccgaag gaaagaaccc tgccgaatgg gctaagaatc tgaagcagga agacttcgag      1740
     ttgctctgcc ctgatggcac caggaagcct gtgaaagatt ttgccagctg ccacctggcc      1800
     caagctccaa accatgttgt ggtctcacga aaagagaagg cagcccgggt taaggctgta      1860
     ctgactagcc aggagacttt atttggggga agtgactgca ccggcaattt ctgtttgttc      1920
     aagtctacca ccaaggacct tctgttcagg gatgacacca aatgtttcgt taaacttcca      1980
     gagggtacca cacctgaaaa atacttagga gcggagtaca tgcaatctgt cggtaacatg      2040
     aggaagtgct caacctcacg actcctagaa gcctgcactt tccacaaaag ttaa            2094
//