Dbfetch

ID   AF439712; SV 1; linear; genomic DNA; STD; HUM; 350 BP.
XX
AC   AF439712;
XX
DT   26-NOV-2001 (Rel. 69, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 3)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*15New allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-350
RA   Varney M.D., Bowman S.M., Tait B.D.;
RT   "A Novel DRB1 Allele Lacks a Codon";
RL   Unpublished.
XX
RN   [2]
RP   1-350
RA   Varney M.D., Bowman S.M., Tait B.D.;
RT   ;
RL   Submitted (24-OCT-2001) to the INSDC.
RL   Victorian Transplantation & Immunogenetics Service, Australian Red Cross
RL   Blood Service, c/o Royal Melbourne Hospital, Grattan St., Parkville, Vic
RL   3050, Australia
XX
DR   MD5; 73fb5895b03f422838e73f0d12709870.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..350
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   exon            31..267
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT   mRNA            <31..>267
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   CDS             <31..>267
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q8WMA1"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q8WMA1"
FT                   /protein_id="AAL35224.1"
FT                   /translation="RFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQDILEQARAAVDTYCRHNYG"
XX
SQ   Sequence 350 BP; 64 A; 89 C; 133 G; 64 T; 0 other;
     cctgtgaccg gatggttcgt gtccccacag cacgtttcct gtggcagcct aagagggagt        60
     gtcatttctt caatgggacg gagcgggtgc ggttcctgga cagatacttc tataaccagg       120
     aggagtccgt gcgcttcgac agcgacgtgg gggagttccg ggcggtgacg gagctggggc       180
     ggcctgacgc tgagtactgg aacagccagg acatcctgga gcaggcgcgg gccgcggtgg       240
     acacctactg cagacacaac tacggggttg tggagagctt cacagtgcag cggcgaggtg       300
     agcatggccg cgggcggggc ctgagtcccc gtgagctggg aatctgagtg                  350
//