Dbfetch

ID   AF432916; SV 1; linear; mRNA; STD; MUS; 1364 BP.
XX
AC   AF432916;
XX
DT   14-NOV-2001 (Rel. 69, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus implantation-related RGS2-like protein mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1364
RA   Shen Q.-X., Wang J., Huang Z.-P.;
RT   "Identification of novel endometrial and embryonic factors involved in
RT   mouse embryo implantation";
RL   Unpublished.
XX
RN   [2]
RP   1-1364
RA   Shen Q.-X., Wang J., Huang Z.-P.;
RT   ;
RL   Submitted (12-OCT-2001) to the INSDC.
RL   Department of Reproductive Biology, Shanghai Institute of Planned
RL   Parenthood Research, 2140 Xie Tu Road, Shanghai 200032, P. R. China
XX
DR   MD5; a17a0f117ab83e90fcae07e70d440216.
DR   Ensembl-Gn; ENSMUSG00000026360; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016565; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0016548; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0016513; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016508; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0016333; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016969; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015912; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0016307; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0016413; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0016411; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0016484; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0016437; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017005; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015698; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015975; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000127206; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0022514; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0022483; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0022450; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0022453; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0022263; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0022966; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0021791; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0022203; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0022327; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0022338; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0022429; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0022306; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0023003; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0021513; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0021832; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1364
FT                   /organism="Mus musculus"
FT                   /strain="Balb/C"
FT                   /mol_type="mRNA"
FT                   /sex="female"
FT                   /tissue_type="D4.5 implantation-site uterus plus embryo"
FT                   /db_xref="taxon:10090"
FT   CDS             11..646
FT                   /codon_start=1
FT                   /product="implantation-related RGS2-like protein"
FT                   /db_xref="GOA:O08849"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="InterPro:IPR024066"
FT                   /db_xref="InterPro:IPR034947"
FT                   /db_xref="MGI:MGI:1098271"
FT                   /db_xref="UniProtKB/Swiss-Prot:O08849"
FT                   /protein_id="AAL28114.1"
FT                   /translation="MQSAMFLAVQHDCVPMDKSAGNGPKVEEKREKMKRTLLKDWKTRL
FT                   SYFLQNSSAPGKPKTGKKSKQQTFIKPSPEEADVWAEAFDELLASKYGLAAFRAFLKSE
FT                   FCEENIEFWLACEDFKKTKSPQKLSSKARKIYTDFIEKEAPKEINIDFQTKSLIAQNIQ
FT                   EATSGCFTTAQKRVYSLMENNSYPRFLESEFYQDLCKKPQITTEPHAT"
XX
SQ   Sequence 1364 BP; 431 A; 275 C; 318 G; 340 T; 0 other;
     gagtctgaga atgcaaagtg ccatgttcct ggctgtccag cacgactgcg tacccatgga        60
     caagagtgca ggcaacggcc ccaaggtcga ggagaagcgg gagaaaatga agcggacact       120
     cttaaaggat tggaagaccc gtttgagcta cttcttgcag aattcctctg ctcctgggaa       180
     gcccaaaact ggcaagaaaa gcaaacagca aacttttatc aagccttctc ctgaggaagc       240
     cgacgtctgg gcagaagcat ttgatgaact gctggccagt aaatatgggc tggctgcatt       300
     cagggcgttt ttaaagtccg agttctgtga agaaaacatt gaattctggt tggcttgtga       360
     agacttcaaa aaaaccaaat caccccaaaa actgtcctca aaagcaagga aaatctatac       420
     cgacttcata gagaaggaag ctcccaaaga gataaacata gacttccaaa cgaaatctct       480
     gattgcccaa aatatccaag aggctacaag tggctgcttc accacagctc agaagagggt       540
     gtacagtttg atggagaaca attcttatcc tcggttcttg gagtccgaat tctaccagga       600
     cttatgtaaa aagccacaga tcaccacgga gccccatgct acatgagacc aggagtcccc       660
     ccacacacaa aggacattcc attctgtctc ccaagagcaa aggctgtgac ctgccagaaa       720
     aaaaaaaaaa actgaccttg aattcagcct gagtgttagg aaaacatcgc tcagaactat       780
     tgattcaatg ttgggtagtg aatcaggaag tcagcaacct aggagaggct ctgtgtgaga       840
     acggcttccc tcactgtgtg aagaacagag ggagggaaca ggcctctgaa tgtgttcttc       900
     ctccttgtcg ggaaagcaga gtttgagatg aaagatccga tgcaatgttg ttggagcatt       960
     taaaatcaat aggtctggga ttatgtggcc ttagctagtt ggctgtacac cttccctaaa      1020
     ctagtccatg ttaccacata gtggtgttag ttctagtttt aatattttag tactaagtaa      1080
     cattacaatg tttactgtgt gcaagggtgt tgacgttctt aggactacag atcattagta      1140
     ctagtgtgtc acgtatcact gaaactgaga agtatgtttg agttgttaaa tggtgtgtgt      1200
     gatggaccga atgctgtgcc gtgctgtaga accagcgtct gttacgagtg ccaaaaactg      1260
     tcttgcgggc agctaaactt tgaagtggtt tttgaatact tttaataaat ttattttgct      1320
     aaataatgtc attgaacaaa aaaaaaaaaa aaaaaaaaaa aaaa                       1364
//