Dbfetch

ID   AF411063; SV 1; linear; mRNA; STD; MUS; 2586 BP.
XX
AC   AF411063;
XX
DT   04-SEP-2001 (Rel. 69, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus cGMP phosphodiesterase 6c (Pde6c) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2586
RA   Chang B., Hawes N.L., Hurd R.E., Davisson M.T., Nusinowitz S.,
RA   Heckenlively J.R.;
RT   "A sequence alteration in Pde6c gene causes cone photoreceptor function
RT   loss (cpfl1) in mice";
RL   Unpublished.
XX
RN   [2]
RP   1-2586
RA   Chang B., Hawes N.L., Hurd R.E., Davisson M.T., Nusinowitz S.,
RA   Heckenlively J.R.;
RT   ;
RL   Submitted (16-AUG-2001) to the INSDC.
RL   The Jackson Laboratory, 600 Main Street, Bar Harbor, ME 04609, USA
XX
DR   MD5; 0a92e2c04dfbb20a30d9b4063a6509ab.
DR   Ensembl-Gn; ENSMUSG00000024992; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025956; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112329; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2586
FT                   /organism="Mus musculus"
FT                   /chromosome="19"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /tissue_type="retina"
FT                   /db_xref="taxon:10090"
FT   CDS             1..2586
FT                   /codon_start=1
FT                   /gene="Pde6c"
FT                   /product="cGMP phosphodiesterase 6c"
FT                   /note="PDE6C"
FT                   /db_xref="GOA:Q91ZQ1"
FT                   /db_xref="InterPro:IPR002073"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR023088"
FT                   /db_xref="InterPro:IPR023174"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="MGI:MGI:105956"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q91ZQ1"
FT                   /protein_id="AAK96254.1"
FT                   /translation="MGEISQEAVERYLEKNPCFAKEYFDKKLRVEALGVIFKNSHAGVQ
FT                   TGLSLPEMTQVEESAVCLELLQCMQDEAGSAEQMAHRALQRLAQLLQADCCSMFSCRAR
FT                   NGIPEVASRLLNVTPTSKFEDNLVAPDREVVFPLDIGIVGWVAHVKKALNVSDVKKNSH
FT                   FSDFMDKQTGYVTRNLLAVPIVAGKEVLAVVMAVNKISAPEFSKQDEEVFSKYLSFVAV
FT                   ALRLQHTSYLYSVESRRSQILMWSANKVFEELTDVERQFHKALYTIRTYLNCDRYSIGL
FT                   LDMTKEKEFYDEWPIKLGEVEPYKGPKTPDGREIIFYKIIDYILHGKEEINVIPSPPAD
FT                   HWTLVSGLPTYVAENGFICNMLNAPADEYFTFQKGPVDETGWVIKNVLSLPIVNKKEDI
FT                   VGVATFYNRKDGKPFDEHDEHITETLTQFLGWSLLNTDTYERVNKLESRKDIAQEMVMN
FT                   LTKATPDEISSILKFKEKLNVEVIEECEERQLLAILKEDLPDPRTADLYEFCFSDFPIT
FT                   EHELVKCGLRLFLEINVVEKFKVPVEVLTRWMYTVRKGYRPVTYHNWRHGFNVGQTMFT
FT                   LLMTGRLKKYYTDLEAFAMLAAAFCHDIDHRGTNNLYQMKSTSPLARLHGTSILERHHL
FT                   EYSKTLLQDESLNIFQNLNKRQFETVIHLFEVAIIATDLALYFKKRTMFQKIVDTCEQM
FT                   QSEEETIKYVTSDPTKKEVIMAMMMTACDLSAITKPWEVQSQVALLVANEFWEQGDLER
FT                   TVLQQQPIPMMDRSKKDELPKLQVGFIDFVCTFVYKEFSRFHGEITPMLNGLQNNRVEW
FT                   KSLAEEYEAKVKVTEEEAGKQEEEASDGKAATDLGGSAEDKKSKTCLML"
XX
SQ   Sequence 2586 BP; 755 A; 558 C; 676 G; 597 T; 0 other;
     atgggtgaga tcagccaaga ggccgtggag cgctacctgg agaagaaccc ttgttttgcc        60
     aaggagtatt ttgacaagaa actacgggtg gaggcactgg gggtgatctt caaaaacagc       120
     catgcagggg tccagaccgg cttgtcgctc cctgagatga cacaggtgga ggagtcggcc       180
     gtgtgcctgg agctactgca gtgtatgcag gacgaggccg gaagcgcgga gcagatggct       240
     caccgggcac tgcagaggct cgctcaactt ctgcaggctg attgctgcag tatgttctcg       300
     tgcagagcaa gaaacggcat accagaggtg gcctccaggc tgctgaacgt caccccaact       360
     tctaagtttg aggacaacct cgtggcccct gacagagaag ttgtatttcc gttggacatt       420
     gggatagttg gctgggtcgc tcatgtgaag aaagccctta atgtctcaga tgtcaaaaag       480
     aacagccatt tttctgactt tatggacaag caaactggat atgtcaccag gaatctgctg       540
     gcagtcccga ttgtggcggg caaggaggtc cttgctgtgg tcatggcagt gaacaaaatc       600
     agcgctcccg agttttccaa acaggatgag gaggtctttt ctaagtacct cagctttgtt       660
     gctgtcgcac taaggctgca gcacaccagt tacctgtaca gtgtggagtc ccggagaagc       720
     cagatcctta tgtggtcagc caataaagta ttcgaagagc tcactgatgt tgagcgacag       780
     tttcacaagg cactgtacac catcaggacg tacctgaact gcgatcgcta ctccattggt       840
     cttctggaca tgaccaagga gaaggaattt tacgatgagt ggccaatcaa gcttggagaa       900
     gttgagcctt ataaaggacc aaagactcca gatggcaggg aaatcatctt ctataaaatc       960
     atcgattaca ttttacatgg aaaagaagag atcaacgtga ttccgtcacc tccagcagac      1020
     cactggacgc ttgttagtgg attgccaaca tacgttgcag aaaatggatt tatctgtaac      1080
     atgctgaatg cccctgcaga tgagtacttc acatttcaga aaggaccggt agatgagact      1140
     ggctgggtca ttaaaaatgt cttgtccctg cctattgtca acaagaaaga agacatcgtg      1200
     ggtgtagcta cgttttacaa ccggaaggat gggaaaccct ttgatgagca tgatgaacat      1260
     atcactgaga ctttaaccca gtttcttgga tggtctcttt taaacaccga tacctatgag      1320
     cgagtgaaca agctggaaag cagaaaggac attgctcagg aaatggttat gaacctcaca      1380
     aaagccaccc cggatgaaat cagctctatt ctgaagttta aagagaagtt aaatgtagag      1440
     gtaattgaag agtgtgaaga gagacagctc ctggccatat tgaaggagga cttgccggac      1500
     ccgagaacag cagacctgta cgagttctgt ttcagcgact tccccattac ggagcacgag      1560
     ttggttaaat gcgggctgag gctgtttttg gagataaacg tggtggagaa attcaaagtc      1620
     cctgtagagg ttcttacaag gtggatgtac acagtccgga aagggtaccg tcctgtcacc      1680
     taccacaact ggcggcacgg attcaacgtg gggcagacca tgttcacttt gttaatgaca      1740
     ggaagactaa agaaatacta tacagacctt gaagcctttg ccatgctcgc tgctgctttc      1800
     tgccatgaca ttgaccacag aggcaccaat aacttgtacc aaatgaagtc cacatctcca      1860
     cttgcaaggc ttcatgggac ttccatttta gagcgacatc acctggaata tagcaagact      1920
     ctcttgcagg atgagagttt aaacatcttc cagaatctaa acaagcggca gtttgaaacg      1980
     gtgatccatt tgttcgaggt tgcaataata gcaactgacc tggcactcta tttcaagaag      2040
     agaaccatgt ttcaaaagat cgttgatacc tgcgagcaga tgcaaagtga agaagaaacc      2100
     atcaaatatg taacctccga cccgaccaaa aaggaagtca tcatggccat gatgatgact      2160
     gcctgtgacc tgtctgccat caccaagccc tgggaggtgc agagtcaggt agcacttctg      2220
     gttgcaaatg aattttggga acaaggagat ctggaaagaa cagtgctgca gcagcaacca      2280
     attcctatga tggacagaag caaaaaggat gaactcccga aacttcaagt gggatttatt      2340
     gattttgttt gtactttcgt atataaggag ttctctcggt ttcatggaga gatcacaccc      2400
     atgctgaacg gccttcagaa taacagggtg gaatggaaat ccctggcgga ggagtacgag      2460
     gcgaaggtga aggtgactga agaagaggcg ggaaagcagg aagaagaagc ctcagatgga      2520
     aaagctgcca cagatttagg aggcagcgcc gaagacaaaa agtccaaaac atgcttaatg      2580
     ttataa                                                                 2586
//