Dbfetch

ID   AF403768; SV 1; linear; genomic DNA; STD; MUS; 1953 BP.
XX
AC   AF403768;
XX
DT   05-SEP-2001 (Rel. 69, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Mus musculus pro-MMP-9 (Mmp9) gene, promoter region and partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1953
RX   DOI; 10.1016/S0006-291X(02)02283-0.
RX   PUBMED; 12359218.
RA   Chicoine E., Esteve P.-O., Robledo O., Van Themsche C., Potworowski E.F.,
RA   St-Pierre Y.;
RT   "Evidence for the role of promoter methylation in the regulation of MMP-9
RT   gene expression";
RL   Biochem. Biophys. Res. Commun. 297(4):765-772(2002).
XX
RN   [2]
RP   1-1953
RA   Chicoine E., Esteve P.-O., Robledo O.;
RT   "Murine MMP-9 promoter of lymphoma cells lines";
RL   Unpublished.
XX
RN   [3]
RP   1-1953
RA   Chicoine E., Van Themsche C.;
RT   ;
RL   Submitted (26-JUL-2001) to the INSDC.
RL   CSH, INRS-IAF, 531 Boul.-Des-Prairies, Laval, Quebec H7V 1B7, Canada
XX
DR   MD5; 271fcdb29fa2eb917d669064c2c75d39.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1953
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/Ka"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="lymphoma"
FT                   /db_xref="taxon:10090"
FT   regulatory      1..1329
FT                   /gene="Mmp9"
FT                   /regulatory_class="promoter"
FT   mRNA            join(1330..1489,1927..>1953)
FT                   /gene="Mmp9"
FT                   /product="pro-MMP-9"
FT   CDS             join(1349..1489,1927..>1953)
FT                   /codon_start=1
FT                   /gene="Mmp9"
FT                   /product="pro-MMP-9"
FT                   /note="zymogen; protease"
FT                   /db_xref="GOA:Q91ZS5"
FT                   /db_xref="InterPro:IPR028688"
FT                   /db_xref="UniProtKB/TrEMBL:Q91ZS5"
FT                   /protein_id="AAK97498.1"
FT                   /translation="MSPWQPLLLALLAFGCSSAAPYQRQPTFVVFPKDLKTSNLTDTQL
FT                   AEAYLYRYGYT"
XX
SQ   Sequence 1953 BP; 448 A; 492 C; 589 G; 424 T; 0 other;
     gagagttttg tagagagcgt atcacaacgt ccaacacaat aaatcaaaaa agtgaatgat        60
     cactgcggcc tggaggtgaa atgccttgcc caaggtggtt gggaaatgac gaggttggga       120
     aatggtagac ccagaactgc aattcagtgc tggagctcac cagtgagaag catctaagag       180
     aagcttggga gaacacccag ctctctctct ccggctcaca ggtctgttcg ttgggaagca       240
     catgaaggtc tgggcacaca ggaggcttag tcagaacagc ttgctgaaga cagatcaagg       300
     ccctgctcca ccatggtggc aggcgaggag gatggaaggc cgggggctgc cggctgttgg       360
     caagactgtg ccaaagcttt cctgagtgga gcagggcagg gctggaggag gggaagggtc       420
     catgacgatc tcacagctcg ggagaggaag gtgtttgccc catccaggtc accccaaggc       480
     ttagagccaa gaccccagtc tcctaatttc caatcacaaa cctgacacca tcaactgagg       540
     tctcgtgaac actgctgaaa gtggtttttc tgtgtttcga gagtctcatt ttatcctcag       600
     atcaatatag ggacaaaggc ttgagcgaca aagggtctgt ttttgttctt taaacagaag       660
     aggaaggata gtgctagcct gagaaggatg aagcttctgc ttgctcccac atgtgtgtgt       720
     ccccccgccc cccaggctca tctttccttc cccaaggagt cagcctgctg gagctagggg       780
     tttgccccat ggaattcccc aaatcctgcc tcaaagagcc tgctcccaga ggccaggaga       840
     ggaagctgag tcaaagactc tatcaggggg cggggatgag aggatagaac ctacagtgtg       900
     gggatgggct ccaggctgca ctctggccag ggagggggtg tctcagaagc ccaaggaaga       960
     ggggtctcgg gcctcaggtc tcccagtctt ttactgggct gatcagtcag ggccgtcaga      1020
     cctgggctag gtgaatgccc catcctgcac accctccttc cctttcccac aaagtctgca      1080
     gtttgcagaa actaaaccct gagttctgtg gtttcctgtg ggtctggggg tcctgcctga      1140
     cttggcaatg ggggactgtg ggcagggcat aagggagggg gtagtgtaaa cacacacaca      1200
     cacacacaca cacacacaca cacacacaca cacacacacg ctgagtcagc ataagcctgg      1260
     aggggagggg cggggtcact gattccgttt tactgcctct ttaaaatctc tgcaaaggca      1320
     gcgttagcca gaagctgcgg tcctcaccat gagtccctgg cagcccctgc tcctggctct      1380
     cctggctttc ggctgcagct ctgctgcccc ttaccagcgc cagccgactt ttgtggtctt      1440
     ccccaaagac ctgaaaacct ccaacctcac ggacacccag ctggcagagg tagacagatg      1500
     gctcggtgga tagctgagaa gggctggtca ggaagatgtc cccctctccc aaggaatggg      1560
     gcctcagata tgctttctgg atttgggggt gatgggcatg tctgccaggg ttaggcagta      1620
     gggggtaggt ggtctggagg ctctgggcag attcgggtct gttggaggga cagattgggt      1680
     tcggcttcga agggttgtga catggcgcag gttggcagtg aacagttaaa ctctagtggg      1740
     gctgaggggt aggcatggtt tatatcatct gaggtcgagg tgtgatgctg tcctcaggat      1800
     aggggaattc tagctgtgta ggaagaactg gtgtcctggc cgtagagtcc ctaagcatgt      1860
     ggcccagagg tccagagcca aggtgccaga actctgtgat gtctgtcccc cttcctccat      1920
     ccacaggcat acttgtaccg ctatggttac acc                                   1953
//