spacer

EBI Dbfetch

ID   AF400066; SV 1; linear; genomic DNA; STD; HUM; 476 BP.
XX
AC   AF400066;
XX
DT   14-AUG-2001 (Rel. 68, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-476
RX   DOI; 10.1111/j.0001-2815.2004.00275.x.
RX   PUBMED; 15304015.
RA   Chu C.C., Lee H.L., Hsieh N.K., Trejaut J., Lin M.;
RT   "Two novel HLA-DRB1 alleles identified using a sequence-based typing:
RT   HLA-DRB1*1443 and HLA-DRB1*1351*";
RL   Tissue Antigens 64(3):308-310(2004).
XX
RN   [2]
RP   1-476
RA   Chu C.-C., Lin M.;
RT   "A HLA-DRB1 new variant found in Taiwan population";
RL   Unpublished.
XX
RN   [3]
RP   1-476
RA   Chu C.-C., Lin M.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Medical Research Department, Mackay Memorial Hospital, 92, Sec2, Chung-Shan
RL   N Rd., Taipei 104, Taiwan
XX
DR   MD5; 56cdd59fc4fa6f1bbdebab76d7befe25.
DR   Ensembl-Gn; ENSG00000196126; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228080; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000360004; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
DR   Ensembl-Tr; ENST00000412634; homo_sapiens.
DR   Ensembl-Tr; ENST00000415796; homo_sapiens.
DR   Ensembl-Tr; ENST00000419393; homo_sapiens.
DR   Ensembl-Tr; ENST00000428566; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..476
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>476
FT                   /gene="HLA-DRB1"
FT   mRNA            <174..>443
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   CDS             <174..>443
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q9GIY3"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*14:43"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9GIY3"
FT                   /protein_id="AAK85431.1"
FT                   /translation="RFLEYSTSECQFFNGTERVRFLDRYFHNQEEFVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLERRRAEVDAYCRHNYGVVESFTVQRR"
FT   exon            174..443
FT                   /gene="HLA-DRB1"
FT                   /number=2
XX
SQ   Sequence 476 BP; 82 A; 124 C; 182 G; 88 T; 0 other;
     gcctcaggaa gacagaggag gagcccctgg gctgcagatg gtgggcgttg cggcgggggc        60
     cggttaaggt tcccagtgcc tgcaccccgc ccagggagcc ccggatggtg gcgtcactgt       120
     cagtgtcttc tcaggaggcc gcctgtgtga ctggatcgtt cgtgtcccca cagcacgttt       180
     cttggagtac tctacgtctg agtgtcaatt cttcaatggg acggagcggg tgcggttcct       240
     ggacagatac ttccataacc aggaggagtt cgtgcgcttc gacagcgacg tgggggagta       300
     ccgggcggtg acggagctgg ggcggcctga tgctgagtac tggaacagcc agaaggacct       360
     cctggagcgg aggcgggccg aggtggacgc ctattgcaga cacaactacg gggttgtgga       420
     gagcttcaca gtgcagcggc gaggtgagcg cggcgcgggg cggggcctga gtccct           476
//


spacer
spacer